Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6840
Gene name
LocationContig_67:18469..22179
Strand+
Gene length (bp)3710
Transcript length (bp)3237
Coding sequence length (bp)3237
Protein length (aa) 1079

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02233 PNTB NAD(P) transhydrogenase beta subunit 2.8E-167 620 1071
PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain 7.4E-75 215 437
PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain 2.1E-45 76 211
PF12769 PNTB_4TM 4TM region of pyridine nucleotide transhydrogenase, mitoch 1.2E-29 501 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 69 1078 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 69 1078 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 69 1078 0.0E+00
sp|P43842|PNTA_HAEIN NAD(P) transhydrogenase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntA PE=3 SV=1 73 585 1.0E-157
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 75 585 3.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 69 1078 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 69 1078 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 69 1078 0.0E+00
sp|P43842|PNTA_HAEIN NAD(P) transhydrogenase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntA PE=3 SV=1 73 585 1.0E-157
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 75 585 3.0E-156
sp|Q9ALA2|PNTA_RHOSH NAD(P) transhydrogenase subunit alpha OS=Rhodobacter sphaeroides GN=pntA PE=1 SV=1 75 585 2.0E-152
sp|P0AB70|PNTB_SHIFL NAD(P) transhydrogenase subunit beta OS=Shigella flexneri GN=pntB PE=3 SV=1 615 1073 2.0E-133
sp|P0AB67|PNTB_ECOLI NAD(P) transhydrogenase subunit beta OS=Escherichia coli (strain K12) GN=pntB PE=1 SV=1 615 1073 2.0E-133
sp|P0AB68|PNTB_ECOL6 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pntB PE=3 SV=1 615 1073 2.0E-133
sp|P0AB69|PNTB_ECO57 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O157:H7 GN=pntB PE=3 SV=1 615 1073 2.0E-133
sp|P43010|PNTB_HAEIN NAD(P) transhydrogenase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntB PE=3 SV=1 617 1073 6.0E-130
sp|P0C188|PNTB_RHORU NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum GN=pntB PE=1 SV=1 618 1074 6.0E-104
sp|Q2RSB4|PNTB_RHORT NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntB PE=1 SV=1 618 1074 6.0E-104
sp|P0C186|PNTAA_RHORU NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum GN=pntAA PE=3 SV=1 75 442 1.0E-93
sp|Q2RSB2|PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAA PE=1 SV=1 75 442 1.0E-93
sp|P41077|PNTAA_RICPR NAD(P) transhydrogenase subunit alpha part 1 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAA PE=3 SV=2 80 437 4.0E-80
sp|Q8KY18|DHA_MYCSM Alanine dehydrogenase OS=Mycobacterium smegmatis GN=ald PE=1 SV=1 73 442 2.0E-31
sp|A0QVQ8|DHA_MYCS2 Alanine dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ald PE=1 SV=1 73 442 2.0E-31
sp|Q931P7|DHA2_STAAM Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald2 PE=3 SV=1 75 405 1.0E-29
sp|Q6GFZ8|DHA2_STAAR Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MRSA252) GN=ald2 PE=3 SV=1 75 405 2.0E-29
sp|Q2FG29|DHA2_STAA3 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain USA300) GN=ald2 PE=3 SV=1 75 405 2.0E-29
sp|Q2FXL7|DHA2_STAA8 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald2 PE=3 SV=1 75 405 2.0E-29
sp|Q5HF65|DHA2_STAAC Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain COL) GN=ald2 PE=3 SV=1 75 405 2.0E-29
sp|Q8NW54|DHA2_STAAW Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MW2) GN=ald2 PE=3 SV=1 75 405 2.0E-29
sp|P9WQB1|DHA_MYCTU Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ald PE=1 SV=1 75 412 2.0E-29
sp|Q99TF4|DHA2_STAAN Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain N315) GN=ald2 PE=1 SV=1 75 405 2.0E-29
sp|Q2YTD1|DHA2_STAAB Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald2 PE=3 SV=1 75 405 2.0E-29
sp|Q6G8L8|DHA2_STAAS Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MSSA476) GN=ald2 PE=3 SV=1 75 405 2.0E-29
sp|P9WQB0|DHA_MYCTO Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ald PE=3 SV=1 75 412 3.0E-29
sp|Q4L750|DHA_STAHJ Alanine dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ald PE=3 SV=1 75 405 1.0E-28
sp|Q8CNW8|DHA_STAES Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ald PE=3 SV=1 75 405 2.0E-28
sp|Q5HNJ6|DHA_STAEQ Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ald PE=3 SV=1 75 405 2.0E-28
sp|P17556|DHA_LYSSH Alanine dehydrogenase OS=Lysinibacillus sphaericus GN=ald PE=1 SV=1 75 418 5.0E-27
sp|Q49YD9|DHA_STAS1 Alanine dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ald PE=3 SV=1 73 405 1.0E-26
sp|Q08352|DHA_BACSU Alanine dehydrogenase OS=Bacillus subtilis (strain 168) GN=ald PE=1 SV=1 73 412 6.0E-26
sp|Q8CX61|DHA_OCEIH Alanine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ald PE=3 SV=1 73 412 8.0E-26
sp|P17557|DHA_GEOSE Alanine dehydrogenase OS=Geobacillus stearothermophilus GN=ald PE=1 SV=1 75 437 4.0E-21
sp|Q8NWQ3|DHA1_STAAW Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MW2) GN=ald1 PE=3 SV=1 73 434 5.0E-21
sp|Q6GGW9|DHA1_STAAR Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MRSA252) GN=ald1 PE=3 SV=1 73 434 5.0E-21
sp|Q2FH00|DHA1_STAA3 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain USA300) GN=ald1 PE=3 SV=1 73 434 5.0E-21
sp|Q5HFY4|DHA1_STAAC Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain COL) GN=ald1 PE=3 SV=1 73 434 5.0E-21
sp|P63478|DHA1_STAAM Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald1 PE=3 SV=1 73 434 5.0E-21
sp|P99151|DHA1_STAAN Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain N315) GN=ald1 PE=1 SV=1 73 434 5.0E-21
sp|Q2YY66|DHA1_STAAB Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald1 PE=3 SV=1 73 438 5.0E-21
sp|Q6G9C3|DHA1_STAAS Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MSSA476) GN=ald1 PE=3 SV=1 73 434 5.0E-21
sp|Q2FYJ2|DHA1_STAA8 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald1 PE=3 SV=1 73 434 5.0E-20
sp|P51995|PNTAB_RICPR NAD(P) transhydrogenase subunit alpha part 2 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAB PE=3 SV=2 503 585 1.0E-19
sp|Q6LX40|DHA_METMP Alanine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=ald PE=1 SV=1 73 371 3.0E-19
sp|P0C187|PNTAB_RHORU NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum GN=pntAB PE=3 SV=1 503 585 2.0E-18
sp|Q2RSB3|PNTAB_RHORT NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAB PE=3 SV=1 503 585 2.0E-18
sp|Q9CG73|CEO1_LACLA N(5)-(carboxyethyl)ornithine synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ceo PE=3 SV=1 75 402 4.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 493 515 22
2 527 549 22
3 553 575 22
4 592 611 19
5 616 638 22
6 645 667 22
7 671 690 19
8 703 725 22
9 735 757 22
10 778 800 22
11 820 842 22
12 854 876 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6840
MASLLRPLASSVLAAVPPAARRHANPSKPLWCRRSWHNRAAQEQFTKTLSRGTPRLKASYSTASPSTTPYSEIVV
GVPAETFPGERRVALTPANAALLLKKGFKQVLVQRGAGALADFLDDAYTQAGATLVDAASVWSRSHVLLKVRGPS
PQEVKAMHEKQTLISFLQPAQNKDLVRHIAGKKATSFAMDMIPRISRAQVFDALSSMANIAGYRAVLEASNVFGR
FLTGQVTAAGKIPPCKVLVIGAGVAGLSAIATARRMGAIVRGFDTRPAVREQVQSLGAEFVEVDMHEDGSGAGGY
AKEMSKEFVEAEMKLFRKQAQEVDIIITTALIPGKPAPRLITKDMLQVMKPGSVIVDLAAEAGGNCEATQKGEMV
IHNDVKVIGYTDMPSRLPTQASTLYSNNVTKFLLSMAPANKEFGIDLQDEVVRGAIVTQDGKELPPAPRPAPPPA
PTKPAAEAIPVPVAMTPWQKKTREVTAVTSGMGVALALGKFTGPIFMSNAFTFALASLIGYRVVWGVQPALHSPL
MSVTNAISGMVGIGGLFVMGGGLLPETVPQLLGAASVLLAFVNVGGGFVITKRMLDMFKRPTDPPEYPWLYSIPA
IVFGGGFIAAASTGAAGLVQAGYLVSTVLCIGSLSGLASQTTARMGNMLGMLGVGSGVLASLLAVGFSPEVLAQF
GGLAAIGTLAGILIGKRITPTDLPQTVAALHSVVGLAAVLTSIGSVMAHISDVSTLHMVTAYLGVLIGGITFTGS
IVAFLKLAGRMSSRPKILPARHAVNAGLLATNAATMGAFITMAPGNALIAAGALAANTALSFIKGYTTTAAIGGA
DMPVVITVLNAYSGFALVAEGLMLNNPLLTSVGALIGVSGSILSYIMCVAMNRSLTNVLFGGLATPTAVQEYQPQ
GTVTQTSADEVADALLGAESVILVVGYGMAVAKAQYALAEIVATLRARGVKVRFAIHPVAGRMPGQCNVLLAEAS
VPYDIVLEMDEINEDFPETDLTVVIGANDTVNPISMEKGSAIEGMPVLHAWKSKQVIVMKRSLASGYADVPNPMF
YMPNTRMLFGDAKISCEAIKKAVEAKLQ*
Coding >OphauB2|6840
ATGGCGTCTTTGCTGCGCCCTCTTGCCTCGAGCGTCTTGGCTGCTGTGCCGCCAGCTGCGCGCCGCCACGCCAAT
CCCTCCAAACCGCTTTGGTGTCGCCGCTCATGGCACAATCGCGCCGCCCAAGAGCAATTCACAAAGACTCTGTCT
CGTGGTACACCGCGCCTCAAGGCTTCTTACTCGACTGCATCCCCCAGCACAACTCCATACAGCGAAATCGTCGTG
GGCGTGCCTGCCGAGACCTTTCCGGGTGAACGGAGAGTCGCCTTGACGCCTGCTAATGCTGCCTTGCTGCTCAAA
AAGGGCTTCAAGCAGGTGCTTGTCCAGCGAGGTGCTGGTGCTCTAGCCGACTTTTTGGACGACGCCTACACTCAA
GCCGGCGCCACCTTGGTTGATGCTGCCAGTGTCTGGTCGCGCTCGCATGTCCTGCTCAAGGTGCGTGGCCCGTCG
CCCCAAGAGGTCAAGGCCATGCACGAAAAACAAACTCTCATATCCTTCCTGCAACCCGCTCAAAACAAGGACTTG
GTCCGCCACATTGCCGGTAAAAAGGCGACAAGCTTCGCCATGGACATGATTCCTCGCATCTCGCGGGCCCAGGTC
TTTGATGCCCTCAGCAGCATGGCCAACATTGCTGGCTATCGCGCCGTGCTCGAAGCCTCGAATGTCTTTGGCCGC
TTTCTCACAGGGCAGGTCACTGCTGCCGGCAAGATTCCTCCCTGCAAAGTGCTTGTTATTGGCGCTGGCGTGGCT
GGACTCAGCGCCATTGCCACAGCCCGGCGCATGGGGGCCATTGTTCGAGGCTTTGACACTCGTCCTGCCGTGCGC
GAGCAAGTCCAGTCTCTGGGTGCCGAGTTTGTCGAAGTCGACATGCATGAAGATGGTTCAGGCGCCGGCGGCTAT
GCCAAGGAAATGAGCAAGGAATTCGTCGAGGCGGAAATGAAGCTCTTTCGCAAACAGGCTCAAGAGGTTGACATT
ATTATTACTACGGCCCTCATCCCTGGAAAACCCGCGCCGCGTCTCATCACCAAGGACATGCTCCAGGTCATGAAG
CCGGGCAGCGTCATTGTCGACTTGGCTGCAGAGGCGGGCGGCAACTGCGAGGCGACTCAAAAGGGAGAAATGGTT
ATTCACAATGATGTCAAGGTCATTGGATACACTGATATGCCGTCGAGGCTCCCTACCCAGGCCTCGACCCTTTAC
TCCAACAATGTCACCAAGTTTCTGCTCTCCATGGCTCCAGCCAACAAGGAATTCGGCATCGATTTGCAAGACGAG
GTTGTGCGAGGTGCCATTGTCACACAAGATGGAAAGGAGTTGCCTCCTGCGCCGCGTCCAGCACCACCTCCAGCC
CCTACCAAGCCGGCAGCCGAGGCCATTCCGGTGCCGGTTGCCATGACTCCATGGCAAAAAAAGACGCGCGAGGTG
ACTGCCGTGACGTCTGGCATGGGTGTTGCTCTGGCACTGGGAAAGTTTACCGGACCAATCTTCATGTCCAATGCC
TTTACCTTTGCCCTTGCAAGTCTGATTGGCTATCGCGTCGTTTGGGGCGTGCAGCCGGCACTGCACTCGCCTCTA
ATGAGCGTGACAAACGCCATTTCGGGCATGGTGGGAATTGGAGGCTTGTTCGTCATGGGGGGAGGCCTGCTCCCA
GAGACGGTGCCGCAGCTCCTTGGGGCCGCGAGTGTGCTTCTCGCCTTTGTCAATGTGGGTGGTGGCTTCGTAATT
ACCAAGCGCATGCTAGACATGTTTAAGCGACCCACGGATCCCCCCGAATATCCATGGCTGTACAGCATTCCTGCA
ATTGTCTTTGGCGGCGGCTTCATTGCCGCTGCATCGACGGGAGCAGCTGGGCTTGTACAGGCTGGCTATCTAGTC
AGCACTGTTCTCTGCATTGGCTCTCTCTCTGGGCTGGCCTCGCAGACGACGGCTCGCATGGGAAACATGCTAGGC
ATGCTCGGCGTTGGCTCCGGTGTTCTCGCCAGTCTGCTGGCTGTTGGCTTCTCTCCAGAGGTCTTGGCTCAGTTT
GGCGGACTTGCCGCCATTGGTACTCTAGCAGGCATTCTCATTGGGAAACGAATCACCCCTACCGATCTGCCCCAG
ACTGTGGCTGCATTGCACTCAGTCGTTGGTTTGGCTGCCGTGTTGACAAGTATTGGTAGCGTCATGGCGCACATT
TCAGATGTATCGACACTGCACATGGTGACTGCGTATCTAGGCGTTCTCATTGGCGGCATCACTTTTACAGGGTCT
ATAGTCGCCTTTCTCAAATTAGCCGGCCGCATGTCGTCGCGTCCCAAGATTCTGCCGGCACGTCATGCCGTTAAT
GCAGGTTTACTGGCAACCAATGCGGCGACAATGGGCGCATTCATTACAATGGCCCCCGGCAATGCTTTGATTGCT
GCTGGAGCTCTTGCTGCAAATACAGCATTGAGTTTTATCAAGGGATATACAACCACGGCTGCCATTGGAGGTGCC
GATATGCCCGTCGTCATCACGGTCCTGAATGCATATAGCGGCTTCGCTCTTGTCGCTGAGGGCTTGATGCTTAAC
AATCCGCTCCTGACGTCTGTCGGCGCCCTGATTGGCGTGTCTGGGTCCATTCTATCGTACATTATGTGCGTGGCC
ATGAACCGATCACTGACAAACGTGCTCTTTGGCGGGCTGGCGACTCCCACGGCGGTGCAGGAGTACCAACCGCAG
GGCACAGTGACGCAAACATCGGCCGACGAAGTTGCCGACGCTCTCTTGGGCGCCGAGTCTGTCATTCTCGTTGTT
GGCTATGGCATGGCAGTAGCCAAGGCCCAGTACGCACTGGCAGAAATCGTGGCCACGCTGCGAGCACGGGGAGTC
AAGGTGCGCTTTGCCATTCATCCCGTGGCGGGCCGCATGCCAGGCCAGTGCAACGTGTTGCTTGCTGAAGCGAGC
GTGCCCTACGACATTGTCCTTGAAATGGATGAAATCAATGAGGATTTCCCCGAGACGGACCTGACAGTCGTCATT
GGAGCCAACGATACCGTCAATCCCATTTCAATGGAAAAGGGGAGTGCAATTGAGGGCATGCCGGTGCTCCATGCG
TGGAAGAGCAAGCAGGTCATTGTCATGAAGCGAAGCCTGGCAAGTGGTTACGCCGATGTACCAAATCCCATGTTT
TACATGCCCAACACGCGCATGTTGTTTGGCGATGCCAAGATTAGCTGCGAAGCCATTAAAAAAGCTGTAGAGGCA
AAGCTGCAGTAG
Transcript >OphauB2|6840
ATGGCGTCTTTGCTGCGCCCTCTTGCCTCGAGCGTCTTGGCTGCTGTGCCGCCAGCTGCGCGCCGCCACGCCAAT
CCCTCCAAACCGCTTTGGTGTCGCCGCTCATGGCACAATCGCGCCGCCCAAGAGCAATTCACAAAGACTCTGTCT
CGTGGTACACCGCGCCTCAAGGCTTCTTACTCGACTGCATCCCCCAGCACAACTCCATACAGCGAAATCGTCGTG
GGCGTGCCTGCCGAGACCTTTCCGGGTGAACGGAGAGTCGCCTTGACGCCTGCTAATGCTGCCTTGCTGCTCAAA
AAGGGCTTCAAGCAGGTGCTTGTCCAGCGAGGTGCTGGTGCTCTAGCCGACTTTTTGGACGACGCCTACACTCAA
GCCGGCGCCACCTTGGTTGATGCTGCCAGTGTCTGGTCGCGCTCGCATGTCCTGCTCAAGGTGCGTGGCCCGTCG
CCCCAAGAGGTCAAGGCCATGCACGAAAAACAAACTCTCATATCCTTCCTGCAACCCGCTCAAAACAAGGACTTG
GTCCGCCACATTGCCGGTAAAAAGGCGACAAGCTTCGCCATGGACATGATTCCTCGCATCTCGCGGGCCCAGGTC
TTTGATGCCCTCAGCAGCATGGCCAACATTGCTGGCTATCGCGCCGTGCTCGAAGCCTCGAATGTCTTTGGCCGC
TTTCTCACAGGGCAGGTCACTGCTGCCGGCAAGATTCCTCCCTGCAAAGTGCTTGTTATTGGCGCTGGCGTGGCT
GGACTCAGCGCCATTGCCACAGCCCGGCGCATGGGGGCCATTGTTCGAGGCTTTGACACTCGTCCTGCCGTGCGC
GAGCAAGTCCAGTCTCTGGGTGCCGAGTTTGTCGAAGTCGACATGCATGAAGATGGTTCAGGCGCCGGCGGCTAT
GCCAAGGAAATGAGCAAGGAATTCGTCGAGGCGGAAATGAAGCTCTTTCGCAAACAGGCTCAAGAGGTTGACATT
ATTATTACTACGGCCCTCATCCCTGGAAAACCCGCGCCGCGTCTCATCACCAAGGACATGCTCCAGGTCATGAAG
CCGGGCAGCGTCATTGTCGACTTGGCTGCAGAGGCGGGCGGCAACTGCGAGGCGACTCAAAAGGGAGAAATGGTT
ATTCACAATGATGTCAAGGTCATTGGATACACTGATATGCCGTCGAGGCTCCCTACCCAGGCCTCGACCCTTTAC
TCCAACAATGTCACCAAGTTTCTGCTCTCCATGGCTCCAGCCAACAAGGAATTCGGCATCGATTTGCAAGACGAG
GTTGTGCGAGGTGCCATTGTCACACAAGATGGAAAGGAGTTGCCTCCTGCGCCGCGTCCAGCACCACCTCCAGCC
CCTACCAAGCCGGCAGCCGAGGCCATTCCGGTGCCGGTTGCCATGACTCCATGGCAAAAAAAGACGCGCGAGGTG
ACTGCCGTGACGTCTGGCATGGGTGTTGCTCTGGCACTGGGAAAGTTTACCGGACCAATCTTCATGTCCAATGCC
TTTACCTTTGCCCTTGCAAGTCTGATTGGCTATCGCGTCGTTTGGGGCGTGCAGCCGGCACTGCACTCGCCTCTA
ATGAGCGTGACAAACGCCATTTCGGGCATGGTGGGAATTGGAGGCTTGTTCGTCATGGGGGGAGGCCTGCTCCCA
GAGACGGTGCCGCAGCTCCTTGGGGCCGCGAGTGTGCTTCTCGCCTTTGTCAATGTGGGTGGTGGCTTCGTAATT
ACCAAGCGCATGCTAGACATGTTTAAGCGACCCACGGATCCCCCCGAATATCCATGGCTGTACAGCATTCCTGCA
ATTGTCTTTGGCGGCGGCTTCATTGCCGCTGCATCGACGGGAGCAGCTGGGCTTGTACAGGCTGGCTATCTAGTC
AGCACTGTTCTCTGCATTGGCTCTCTCTCTGGGCTGGCCTCGCAGACGACGGCTCGCATGGGAAACATGCTAGGC
ATGCTCGGCGTTGGCTCCGGTGTTCTCGCCAGTCTGCTGGCTGTTGGCTTCTCTCCAGAGGTCTTGGCTCAGTTT
GGCGGACTTGCCGCCATTGGTACTCTAGCAGGCATTCTCATTGGGAAACGAATCACCCCTACCGATCTGCCCCAG
ACTGTGGCTGCATTGCACTCAGTCGTTGGTTTGGCTGCCGTGTTGACAAGTATTGGTAGCGTCATGGCGCACATT
TCAGATGTATCGACACTGCACATGGTGACTGCGTATCTAGGCGTTCTCATTGGCGGCATCACTTTTACAGGGTCT
ATAGTCGCCTTTCTCAAATTAGCCGGCCGCATGTCGTCGCGTCCCAAGATTCTGCCGGCACGTCATGCCGTTAAT
GCAGGTTTACTGGCAACCAATGCGGCGACAATGGGCGCATTCATTACAATGGCCCCCGGCAATGCTTTGATTGCT
GCTGGAGCTCTTGCTGCAAATACAGCATTGAGTTTTATCAAGGGATATACAACCACGGCTGCCATTGGAGGTGCC
GATATGCCCGTCGTCATCACGGTCCTGAATGCATATAGCGGCTTCGCTCTTGTCGCTGAGGGCTTGATGCTTAAC
AATCCGCTCCTGACGTCTGTCGGCGCCCTGATTGGCGTGTCTGGGTCCATTCTATCGTACATTATGTGCGTGGCC
ATGAACCGATCACTGACAAACGTGCTCTTTGGCGGGCTGGCGACTCCCACGGCGGTGCAGGAGTACCAACCGCAG
GGCACAGTGACGCAAACATCGGCCGACGAAGTTGCCGACGCTCTCTTGGGCGCCGAGTCTGTCATTCTCGTTGTT
GGCTATGGCATGGCAGTAGCCAAGGCCCAGTACGCACTGGCAGAAATCGTGGCCACGCTGCGAGCACGGGGAGTC
AAGGTGCGCTTTGCCATTCATCCCGTGGCGGGCCGCATGCCAGGCCAGTGCAACGTGTTGCTTGCTGAAGCGAGC
GTGCCCTACGACATTGTCCTTGAAATGGATGAAATCAATGAGGATTTCCCCGAGACGGACCTGACAGTCGTCATT
GGAGCCAACGATACCGTCAATCCCATTTCAATGGAAAAGGGGAGTGCAATTGAGGGCATGCCGGTGCTCCATGCG
TGGAAGAGCAAGCAGGTCATTGTCATGAAGCGAAGCCTGGCAAGTGGTTACGCCGATGTACCAAATCCCATGTTT
TACATGCCCAACACGCGCATGTTGTTTGGCGATGCCAAGATTAGCTGCGAAGCCATTAAAAAAGCTGTAGAGGCA
AAGCTGCAGTAG
Gene >OphauB2|6840
ATGGCGTCTTTGCTGCGCCCTCTTGCCTCGAGCGTCTTGGCTGCTGTGCCGCCAGCTGCGCGCCGCCACGGTACT
TGCATGATTCCCATTCCAGCGAGCCGATGCTATGTCAAATGTCGTCGTGTCCTCTTCTAATCTGCGACACAAGCC
AATCCCTCCAAACCGCTTTGGTGTCGCCGCTCATGGCACAATCGCGCCGCCCAAGAGCAATTCACAAAGACTCTG
TCTCGTGGTACACCGCGCCTCAAGGCTTCTTACTCGACTGCATCCCCCAGCACAACTCCATACAGCGAAATCGTC
GTGGGCGTGCCTGCCGAGACCTTTCCGGGTGAACGGAGAGTCGCCTTGACGCCTGCTAATGCTGCCTTGCTGCTC
AAAAAGGGCTTCAAGCAGGTGCTTGTCCAGCGAGGTGCTGGTGCTCTAGCCGACTTTTTGGACGACGCCTACACT
CAAGCCGGCGCCACCTTGGTTGATGCTGCCAGTGTCTGGTCGCGCTCGCATGTCCTGCTCAAGGTGCGTGGCCCG
TCGCCCCAAGAGGTCAAGGCCATGCACGAAAAACAAACTCTCATATCCTTCCTGCAACCCGCTCAAAACAAGGAC
TTGGTCCGCCACATTGCCGGTAAAAAGGCGACAAGCTTCGCCATGGACATGATTCCTCGCATCTCGCGGGCCCAG
GTCTTTGATGCCCTCAGCAGCATGGCCAACATTGCTGGCTATCGCGCCGTGCTCGAAGCCTCGAATGTCTTTGGC
CGCTTTCTCACAGGGCAGGTCACTGCTGCCGGCAAGATTCCTCCCTGCAAAGTGCTTGTTATTGGCGCTGGCGTG
GCTGGACTCAGCGCCATTGCCACAGCCCGGCGCATGGGGGCCATTGTTCGAGGCTTTGACACTCGTCCTGCCGTG
CGCGAGCAAGTCCAGTCTCTGGGTGCCGAGTTTGTCGAAGTCGACATGCATGAAGATGGTTCAGGCGCCGGCGGC
TATGCCAAGGAAATGAGCAAGGAATTCGTCGAGGCGGAAATGAAGCTCTTTCGCAAACAGGCTCAAGAGGTTGAC
ATTATTATTACTACGGCCCTCATCCCTGGAAAACCCGCGCCGCGTCTCATCACCAAGGACATGCTCCAGGTCATG
AAGCCGGGCAGCGTCATTGTCGACTTGGCTGCAGAGGCGGGCGGCAACTGCGAGGCGACTCAAAAGGGAGAAATG
GTTATTCACAATGATGTCAAGGTCATTGGTAAGTAGTGGCATGTTTGCAGGGCGGGCGGTTTTGCTGACGGTATA
GGATACACTGATATGCCGTCGAGGCTCCCTACCCAGGCCTCGACCCTTTACTCCAACAATGTCACCAAGTTTCTG
CTCTCCATGGCTCCAGCCAACAAGGAATTCGGCATCGATTTGCAAGACGAGGTTGTGCGAGGTGCCATTGTCACA
CAAGATGGAAAGGAGTTGCCTCCTGCGCCGCGTCCAGCACCACCTCCAGCCCCTACCAAGCCGGCAGCCGAGGCC
ATTCCGGTGCCGGTTGCCATGACTCCATGGCAAAAAAAGACGCGCGAGGTGACTGCCGTGACGTCTGGCATGGGT
GTTGCTCTGGCACTGGGAAAGTTTACCGGACCAATCTTCATGTCCAATGCCTTTACCTTTGCCCTTGCAAGTCTG
ATTGGCTATCGCGTCGTTTGGGGCGTGCAGCCGGCACTGCACTCGCCTCTAATGAGCGTGACAAACGCCATTTCG
GGCATGGTGGGAATTGGAGGCTTGTTCGTCATGGGGGGAGGCCTGCTCCCAGAGACGGTGCCGCAGCTCCTTGGG
GCCGCGAGTGTGCTTCTCGCCTTTGTCAATGTGGGTGGTGGCTTCGTAATTACCAAGCGCATGCTAGACATGTTT
AAGCGTCAGTTGAAGCGCTCCGCCTGTATCAAAGTGCTCAAGTGCTCATGGAAACAGGACCCACGGATCCCCCCG
AATATCCATGGCTGTACAGCATTCCTGCAATTGTCTTTGGCGGCGGCTTCATTGCCGCTGCATCGACGGGAGCAG
CTGGGCTTGTACAGGCTGGCTATCTAGTCAGCACTGTTCTCTGCATTGGCTCTCTCTCTGGGCTGGCCTCGCAGA
CGACGGCTCGCATGGGAAACATGCTAGGCATGCTCGGCGTTGGCTCCGGTGTTCTCGCCAGTCTGCTGGCTGTTG
GCTTCTCTCCAGAGGTCTTGGCTCAGTTTGGCGGACTTGCCGCCATTGGTACTCTAGCAGGTGAGTCTCGGGGCA
GTAGTCGTCTTGGACAGCACTAAAGGGAGCTAGGCATTCTCATTGGGAAACGAATCACCCCTACCGATCTGCCCC
AGACTGTGGCTGCATTGCACTCAGTCGTTGGTTTGGCTGCCGTGTTGACAAGTATTGGTAGCGTCATGGCGCACA
TTTCAGATGTATCGACACTGCACATGGTGACTGCGTATCTAGGCGTTCTCATTGGTACGTTTTGACGGATTCCCC
TAAAAGACATCAGGCTGATGTGAAGAATAGGCGGCATCACTTTTACAGGGTCTATAGTCGCCTTTCTCAAATTAG
CCGGCCGCATGTCGTCGCGTCCCAAGATTCTGCCGGCACGTCATGCCGTTAATGCAGGTTTACTGGCAACCAATG
CGGCGACAATGGGCGCATTCATTACAATGGCCCCCGGCAATGCTTTGATTGCTGCTGGAGCTCTTGCTGCAAATA
CAGCATTGAGTTTTATCAAGGGATATACAACCACGGCTGCCATTGGAGGTGCCGATATGCGTGAGTGGCAGCACG
CACGCCCCCCCCTTGGCCATCTCTTAGCGGTGGTTCATGGTCACGGGGCTCGCATTTGGCTGACTGGGAGCAGCC
GTCGTCATCACGGTCCTGAATGCATATAGCGGCTTCGCTCTTGTCGCTGAGGGCTTGATGCTTAACAATCCGCTC
CTGACGTCTGTCGGCGCCCTGATTGGCGTGTCTGGGTCCATTCTATCGTACATTATGTGCGTGGCCATGAACCGA
TCACTGACAAACGTGCTCTTTGGCGGGCTGGCGACTCCCACGGCGGTGCAGGAGTACCAACCGCAGGGCACAGTG
ACGCAAACATCGGCCGACGAAGTTGCCGACGCTCTCTTGGGCGCCGAGTCTGTCATTCTCGTTGTTGGCTATGGC
ATGGCAGTAGCCAAGGCCCAGTACGCACTGGCAGAAATCGTGGCCACGCTGCGAGCACGGGGAGTCAAGGTGCGC
TTTGCCATTCATCCCGTGGCGGGCCGCATGCCAGGCCAGTGCAACGTGTTGCTTGCTGAAGCGAGCGTGCCCTAC
GACATTGTCCTTGAAATGGATGAAATCAATGAGGATTTCCCCGAGACGGACCTGACAGTCGTCATTGGAGCCAAC
GATACCGTCAATCCCATTTCAATGGAAAAGGGGAGTGCAATTGAGGGCATGCCGGTGCTCCATGCGTGGAAGAGC
AAGCAGGTCATTGTCATGAAGCGAAGCCTGGCAAGTGGTTACGGTAAGTTGTGCCAAGCTTGTCTGGCGTGGACA
GGCACGGCTAACAGGTGCAGCCGATGTACCAAATCCCATGTTTTACATGCCCAACACGCGCATGTTGTTTGGCGA
TGCCAAGATTAGCTGCGAAGGTATGCACGGGGTCCCGATAAGGAATCGTGGTGCGGTGCTGACTGAGAGATGTAG
CCATTAAAAAAGCTGTAGAGGCAAAGCTGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail