Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6834
Gene name
LocationContig_67:4587..6112
Strand-
Gene length (bp)1525
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4750
Ophiocordyceps australis map64 (Brazil) OphauB2|6834 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01619
Ophiocordyceps camponoti-rufipedis Ophun1|7407
Ophiocordyceps kimflemingae Ophio5|7578
Ophiocordyceps subramaniannii Hirsu2|4371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6834
MDRQVQIHWTQDYRFRHLRSPPAWYHRRTSPFWTPQPSARMEKQAAFERKGQWQWQGADNASSSFNESCLEATCW
PCGLYARTVMRLHSALAGHDAEYTGDLGFCNADCTQFAACLPFYGFFVSRLQTTIRSFYGISGRNHSDWYDGCCC
PCVTLVRSEQEILLRERQYKRLRSLHDSSSASSQYQSQTPMTYDSSPVKSSTAQTKSSSSPTKSSSAPTQTLSPP
VQWGNSASLAQRPSPRQAAPCSRMAGGDSMTAMGRPMREGSAPGRATAPFGLSVGEAKLMKQPRGNPAAVNASKT
VDVPVIHYLDNEWYMVPVSQSAQTQGDAKKRRASSAAADGTCRADQAIPRKPVPITATLIGRHSLSQHELVSMGV
SSAPKPRCSDEDETSQISPRRLLHRLEEDGSVTGQESPRDEQTAEAEEPSRPPAVAHDATVEQVGPTSKTLDSGV
KVDAASHEAKPAALEASKDVEFEEAPRRPVADTKD*
Coding >OphauB2|6834
ATGGATCGCCAAGTCCAGATCCACTGGACTCAGGACTATCGGTTCCGCCACCTACGAAGCCCTCCTGCTTGGTAT
CATCGGCGCACCAGTCCATTCTGGACACCACAGCCCAGTGCTCGGATGGAAAAACAGGCGGCCTTTGAACGCAAG
GGGCAGTGGCAATGGCAGGGAGCAGATAATGCCTCTAGCTCCTTTAATGAATCGTGCCTCGAGGCCACGTGCTGG
CCCTGTGGTCTCTATGCGCGCACGGTGATGCGCCTACACTCGGCACTGGCTGGCCATGACGCTGAGTATACTGGC
GACCTGGGATTCTGTAATGCTGATTGCACTCAGTTTGCTGCTTGCCTGCCCTTCTACGGCTTCTTTGTCTCGCGC
CTACAGACGACGATTCGCTCCTTTTATGGCATTAGTGGGAGAAACCACTCGGACTGGTACGACGGCTGCTGCTGT
CCCTGTGTTACGCTGGTTCGCAGCGAGCAGGAAATTTTGCTGCGTGAGCGACAATACAAGCGGCTTAGGAGTCTA
CATGATTCCAGTTCGGCCTCGAGCCAGTACCAATCGCAGACGCCCATGACGTACGATAGCTCTCCAGTCAAGTCG
TCGACGGCACAGACCAAGTCGTCTTCAAGTCCCACAAAATCTTCTTCAGCTCCAACGCAAACTTTGTCACCCCCT
GTTCAGTGGGGAAATTCGGCGAGTTTGGCGCAGAGGCCGTCGCCAAGGCAGGCGGCTCCTTGCTCCAGGATGGCT
GGCGGGGACAGTATGACTGCCATGGGCAGGCCAATGAGAGAAGGCTCAGCGCCAGGACGAGCAACGGCGCCATTT
GGCTTGAGTGTTGGGGAAGCCAAGTTGATGAAGCAGCCAAGGGGGAACCCTGCCGCCGTTAATGCTTCCAAGACT
GTTGATGTCCCAGTGATCCACTATCTGGATAACGAGTGGTACATGGTGCCCGTCAGCCAGTCAGCACAGACCCAA
GGGGATGCCAAGAAGAGACGGGCATCGTCGGCCGCGGCTGACGGCACTTGTAGAGCTGACCAAGCAATACCGCGA
AAGCCTGTGCCCATTACGGCCACGTTGATAGGCAGGCATTCACTCAGCCAGCATGAGCTGGTTTCCATGGGCGTA
TCGTCGGCCCCGAAGCCAAGGTGTAGCGATGAAGACGAGACGTCACAAATTAGCCCTCGCCGTCTACTACATCGA
CTGGAAGAGGATGGATCAGTGACGGGCCAAGAGTCGCCAAGAGATGAGCAGACGGCCGAGGCGGAAGAGCCAAGC
AGGCCGCCAGCCGTTGCTCATGATGCAACGGTAGAGCAAGTCGGGCCAACGAGCAAGACGCTAGACAGCGGTGTC
AAGGTTGATGCGGCCAGTCACGAGGCCAAGCCGGCCGCCTTGGAGGCCAGCAAGGATGTGGAGTTTGAGGAGGCG
CCGAGGCGACCTGTCGCGGACACCAAGGACTAG
Transcript >OphauB2|6834
ATGGATCGCCAAGTCCAGATCCACTGGACTCAGGACTATCGGTTCCGCCACCTACGAAGCCCTCCTGCTTGGTAT
CATCGGCGCACCAGTCCATTCTGGACACCACAGCCCAGTGCTCGGATGGAAAAACAGGCGGCCTTTGAACGCAAG
GGGCAGTGGCAATGGCAGGGAGCAGATAATGCCTCTAGCTCCTTTAATGAATCGTGCCTCGAGGCCACGTGCTGG
CCCTGTGGTCTCTATGCGCGCACGGTGATGCGCCTACACTCGGCACTGGCTGGCCATGACGCTGAGTATACTGGC
GACCTGGGATTCTGTAATGCTGATTGCACTCAGTTTGCTGCTTGCCTGCCCTTCTACGGCTTCTTTGTCTCGCGC
CTACAGACGACGATTCGCTCCTTTTATGGCATTAGTGGGAGAAACCACTCGGACTGGTACGACGGCTGCTGCTGT
CCCTGTGTTACGCTGGTTCGCAGCGAGCAGGAAATTTTGCTGCGTGAGCGACAATACAAGCGGCTTAGGAGTCTA
CATGATTCCAGTTCGGCCTCGAGCCAGTACCAATCGCAGACGCCCATGACGTACGATAGCTCTCCAGTCAAGTCG
TCGACGGCACAGACCAAGTCGTCTTCAAGTCCCACAAAATCTTCTTCAGCTCCAACGCAAACTTTGTCACCCCCT
GTTCAGTGGGGAAATTCGGCGAGTTTGGCGCAGAGGCCGTCGCCAAGGCAGGCGGCTCCTTGCTCCAGGATGGCT
GGCGGGGACAGTATGACTGCCATGGGCAGGCCAATGAGAGAAGGCTCAGCGCCAGGACGAGCAACGGCGCCATTT
GGCTTGAGTGTTGGGGAAGCCAAGTTGATGAAGCAGCCAAGGGGGAACCCTGCCGCCGTTAATGCTTCCAAGACT
GTTGATGTCCCAGTGATCCACTATCTGGATAACGAGTGGTACATGGTGCCCGTCAGCCAGTCAGCACAGACCCAA
GGGGATGCCAAGAAGAGACGGGCATCGTCGGCCGCGGCTGACGGCACTTGTAGAGCTGACCAAGCAATACCGCGA
AAGCCTGTGCCCATTACGGCCACGTTGATAGGCAGGCATTCACTCAGCCAGCATGAGCTGGTTTCCATGGGCGTA
TCGTCGGCCCCGAAGCCAAGGTGTAGCGATGAAGACGAGACGTCACAAATTAGCCCTCGCCGTCTACTACATCGA
CTGGAAGAGGATGGATCAGTGACGGGCCAAGAGTCGCCAAGAGATGAGCAGACGGCCGAGGCGGAAGAGCCAAGC
AGGCCGCCAGCCGTTGCTCATGATGCAACGGTAGAGCAAGTCGGGCCAACGAGCAAGACGCTAGACAGCGGTGTC
AAGGTTGATGCGGCCAGTCACGAGGCCAAGCCGGCCGCCTTGGAGGCCAGCAAGGATGTGGAGTTTGAGGAGGCG
CCGAGGCGACCTGTCGCGGACACCAAGGACTAG
Gene >OphauB2|6834
ATGGATCGCCAAGTCCAGATCCACTGGACTCAGGACTATCGGTTCCGCCACCTACGAAGCCCTCCTGCTTGGTAT
CATCGGCGCACCAGTCCATTCTGGACACCACAGCCCAGTGCTCGGATGGAAAAACAGGCGGCCTTTGAACGCAAG
GGGCAGTGGCAATGGCAGGGAGCAGATAATGCCTCTAGCTCCTTTAATGAATCGTGCCTCGAGGCCACGTGCTGG
CCCTGTGGTCTCTATGCGCGCACGGTGATGCGCCTACACTCGGCACTGGCTGGCCATGACGCTGAGTATACTGGC
GACCTGGGATTCTGTAATGCTGATTGCACTCAGTTTGCTGCTTGCCTGCCCTGTAAGTATCGAGGCCATGGCGGT
GCAACAGCCGGGACAAGAGGGGCTAATGCCAAGGCATGCGTCAGTCTACGGCTTCTTTGTCTCGCGCCTACAGAC
GACGATTCGCTCCTTTTATGGCATTAGTGGGAGAAACCACTCGGACTGGTACGACGGCTGCTGCTGTCCCTGTGT
TACGCTGGTTCGCAGCGAGCAGGAAATTTTGCTGCGTGAGCGACAATACAAGCGGCTTAGGAGTCTACATGATTC
CAGTTCGGCCTCGAGCCAGTACCAATCGCAGACGCCCATGACGTACGATAGCTCTCCAGTCAAGTCGTCGACGGC
ACAGACCAAGTCGTCTTCAAGTCCCACAAAATCTTCTTCAGCTCCAACGCAAACTTTGTCACCCCCTGTTCAGTG
GGGAAATTCGGCGAGTTTGGCGCAGAGGCCGTCGCCAAGGCAGGCGGCTCCTTGCTCCAGGATGGCTGGCGGGGA
CAGTATGACTGCCATGGGCAGGCCAATGAGAGAAGGCTCAGCGCCAGGACGAGCAACGGCGCCATTTGGCTTGAG
TGTTGGGGAAGCCAAGTTGATGAAGCAGCCAAGGGGGAACCCTGCCGCCGTTAATGCTTCCAAGACTGTTGATGT
CCCAGTGATCCACTATCTGGATAACGAGTGGTACATGGTGCCCGTCAGCCAGTCAGCACAGACCCAAGGGGATGC
CAAGAAGAGACGGGCATCGTCGGCCGCGGCTGACGGCACTTGTAGAGCTGACCAAGCAATACCGCGAAAGCCTGT
GCCCATTACGGCCACGTTGATAGGCAGGCATTCACTCAGCCAGCATGAGCTGGTTTCCATGGGCGTATCGTCGGC
CCCGAAGCCAAGGTGTAGCGATGAAGACGAGACGTCACAAATTAGCCCTCGCCGTCTACTACATCGACTGGAAGA
GGATGGATCAGTGACGGGCCAAGAGTCGCCAAGAGATGAGCAGACGGCCGAGGCGGAAGAGCCAAGCAGGCCGCC
AGCCGTTGCTCATGATGCAACGGTAGAGCAAGTCGGGCCAACGAGCAAGACGCTAGACAGCGGTGTCAAGGTTGA
TGCGGCCAGTCACGAGGCCAAGCCGGCCGCCTTGGAGGCCAGCAAGGATGTGGAGTTTGAGGAGGCGCCGAGGCG
ACCTGTCGCGGACACCAAGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail