Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6831
Gene name
LocationContig_66:103358..104399
Strand-
Gene length (bp)1041
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup171
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2453
Ophiocordyceps australis 1348a (Ghana) OphauG2|5209
Ophiocordyceps australis 1348a (Ghana) OphauG2|6873
Ophiocordyceps australis map64 (Brazil) OphauB2|6831 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7159
Ophiocordyceps kimflemingae Ophio5|5336
Ophiocordyceps kimflemingae Ophio5|7312
Ophiocordyceps subramaniannii Hirsu2|186
Ophiocordyceps subramaniannii Hirsu2|260
Ophiocordyceps subramaniannii Hirsu2|2751
Ophiocordyceps subramaniannii Hirsu2|9178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6831
MNVPKSSPCLYQGRICRWHGESPLCDRDAHTIGFMTPQHELMASTRYDSISSLCSDAAEGNNPGADCCAQYGQGC
LFGYKRLWCHVEPVVKTDKKEPVPMALGGGELCEWEGRQCQWYGTSPLCLATEYEIGNVDDKAREYVVSTREKSL
GALCAGVKQMTARHCCKSYGSACVDGYKRLWCFPKAGTSTSGRESHSTRVKHQVFLLTEAKLEPLLSSSKQRKSS
PLSSSKPPKSPLPLLPPPDWASHYPCRFRGRTCEWHGSSPFCGRTSTPVGQTHSSSQTLLLTTEHRSITDLCENV
HGADYPGESCCRTYYATCWTGYKRLWCSEERPEAYWETDLWRHGKA*
Coding >OphauB2|6831
ATGAATGTGCCCAAGTCGTCGCCCTGTCTATACCAAGGCCGCATCTGCCGCTGGCACGGCGAATCGCCCCTCTGC
GACCGCGACGCCCACACCATTGGCTTCATGACGCCCCAGCACGAGCTCATGGCCTCGACGCGCTACGACTCCATC
TCATCGCTCTGCTCCGACGCAGCAGAGGGCAACAACCCCGGCGCCGACTGCTGCGCACAGTACGGGCAGGGATGC
CTCTTTGGATATAAGCGGCTATGGTGCCATGTAGAGCCAGTAGTCAAGACGGACAAGAAGGAACCAGTCCCCATG
GCGCTGGGGGGCGGCGAGTTGTGTGAGTGGGAGGGGAGGCAGTGTCAGTGGTATGGCACGTCGCCCTTGTGCTTG
GCCACCGAGTATGAGATTGGAAATGTCGATGACAAGGCGAGAGAGTATGTCGTTTCCACGAGGGAGAAGAGCCTG
GGAGCGCTGTGTGCTGGCGTCAAGCAGATGACGGCGAGGCACTGCTGCAAGAGCTACGGGAGTGCATGTGTGGAT
GGATATAAGCGGCTATGGTGTTTTCCCAAGGCCGGGACAAGTACAAGTGGCAGGGAATCCCATTCGACCAGAGTC
AAGCACCAAGTCTTTTTGTTGACCGAGGCCAAACTTGAGCCGTTACTTTCAAGCAGCAAGCAACGCAAATCATCG
CCTCTTTCAAGCAGCAAGCCCCCCAAATCACCTCTTCCTCTCCTCCCGCCCCCCGACTGGGCCAGCCACTATCCA
TGTCGCTTCCGCGGCCGCACCTGCGAGTGGCACGGCTCCTCCCCCTTTTGCGGCCGCACCTCGACCCCCGTCGGC
CAAACCCACTCCTCGAGCCAAACACTCTTGCTCACAACAGAGCACCGCTCCATCACAGACCTCTGTGAAAACGTG
CATGGCGCAGACTATCCCGGCGAGTCGTGTTGTCGCACCTACTATGCCACCTGCTGGACTGGGTATAAGCGGCTG
TGGTGCTCAGAGGAGCGGCCCGAGGCGTACTGGGAGACGGATTTGTGGCGCCATGGCAAGGCTTGA
Transcript >OphauB2|6831
ATGAATGTGCCCAAGTCGTCGCCCTGTCTATACCAAGGCCGCATCTGCCGCTGGCACGGCGAATCGCCCCTCTGC
GACCGCGACGCCCACACCATTGGCTTCATGACGCCCCAGCACGAGCTCATGGCCTCGACGCGCTACGACTCCATC
TCATCGCTCTGCTCCGACGCAGCAGAGGGCAACAACCCCGGCGCCGACTGCTGCGCACAGTACGGGCAGGGATGC
CTCTTTGGATATAAGCGGCTATGGTGCCATGTAGAGCCAGTAGTCAAGACGGACAAGAAGGAACCAGTCCCCATG
GCGCTGGGGGGCGGCGAGTTGTGTGAGTGGGAGGGGAGGCAGTGTCAGTGGTATGGCACGTCGCCCTTGTGCTTG
GCCACCGAGTATGAGATTGGAAATGTCGATGACAAGGCGAGAGAGTATGTCGTTTCCACGAGGGAGAAGAGCCTG
GGAGCGCTGTGTGCTGGCGTCAAGCAGATGACGGCGAGGCACTGCTGCAAGAGCTACGGGAGTGCATGTGTGGAT
GGATATAAGCGGCTATGGTGTTTTCCCAAGGCCGGGACAAGTACAAGTGGCAGGGAATCCCATTCGACCAGAGTC
AAGCACCAAGTCTTTTTGTTGACCGAGGCCAAACTTGAGCCGTTACTTTCAAGCAGCAAGCAACGCAAATCATCG
CCTCTTTCAAGCAGCAAGCCCCCCAAATCACCTCTTCCTCTCCTCCCGCCCCCCGACTGGGCCAGCCACTATCCA
TGTCGCTTCCGCGGCCGCACCTGCGAGTGGCACGGCTCCTCCCCCTTTTGCGGCCGCACCTCGACCCCCGTCGGC
CAAACCCACTCCTCGAGCCAAACACTCTTGCTCACAACAGAGCACCGCTCCATCACAGACCTCTGTGAAAACGTG
CATGGCGCAGACTATCCCGGCGAGTCGTGTTGTCGCACCTACTATGCCACCTGCTGGACTGGGTATAAGCGGCTG
TGGTGCTCAGAGGAGCGGCCCGAGGCGTACTGGGAGACGGATTTGTGGCGCCATGGCAAGGCTTGA
Gene >OphauB2|6831
ATGAATGTGCCCAAGTCGTCGCCCTGTCTATACCAAGGCCGCATCTGCCGCTGGCACGGCGAATCGCCCCTCTGC
GACCGCGACGCCCACACCATTGGCTTCATGACGCCCCAGCACGAGCTCATGGCCTCGACGCGCTACGACTCCATC
TCATCGCTCTGCTCCGACGCAGCAGAGGGCAACAACCCCGGCGCCGACTGCTGCGCACAGTACGGGCAGGGATGC
CTCTTTGGATATAAGCGGCTATGGTGCCATGTAGAGCCAGTAGTCAAGACGGACAAGAAGGAACCAGTCCCCATG
GCGCTGGGGGGCGGCGAGTTGTGTGAGTGGGAGGGGAGGCAGTGTCAGTGGTATGGCACGTCGCCCTTGTGCTTG
GCCACCGAGTATGAGATTGGAAATGTCGATGACAAGGCGAGAGAGTATGTCGTTTCCACGAGGGAGAAGAGCCTG
GGAGCGCTGTGTGCTGGCGTCAAGCAGATGACGGCGAGGCACTGCTGCAAGAGCTACGGGAGTGCATGTGTGGAT
GGATATAAGCGGCTATGGTGTTTTCCCAAGGCCGGGACAAGTACAAGTGGCAGGGAATCCCATTCGACCAGAGTC
AAGCACCAAGTCTTTTTGTTGACCGAGGCCAAACTTGAGCCGTTACTTTCAAGCAGCAAGCAACGCAAATCATCG
CCTCTTTCAAGCAGCAAGCCCCCCAAATCACCTCTTCCTCTCCTCCCGCCCCCCGACTGGGCCAGCCACTATCCA
TGTCGCTTCCGCGGCCGCACCTGCGAGTGGCACGGCTCCTCCCCCTTTTGCGGCCGCACCTCGACCCCCGTCGGC
CAAACCCACTCCTCGAGCCAAACACTCTTGCTCACAACAGAGCACCGCTCCATCACAGACCTCTGTGAAAACGTG
CATGGCGCAGACTATCCCGGCGAGTCGTGTTGTCGCACCTACTATGCCACCTGCTGGACTGGGTATAAGCGGCTG
TGGTGCTCAGAGGAGCGGCCCGAGGCGTACTGGGAGACGGATTTGTGGCGCCATGGCAAGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail