Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6815
Gene name
LocationContig_66:63300..65091
Strand+
Gene length (bp)1791
Transcript length (bp)1593
Coding sequence length (bp)1593
Protein length (aa) 531

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 9.4E-141 35 523

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 3 530 0.0E+00
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 8 529 0.0E+00
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 3 527 0.0E+00
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 3 527 0.0E+00
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 3 527 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10147|TCPB_SCHPO Probable T-complex protein 1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct2 PE=3 SV=1 3 530 0.0E+00
sp|P39076|TCPB_YEAST T-complex protein 1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT2 PE=1 SV=1 8 529 0.0E+00
sp|Q5XIM9|TCPB_RAT T-complex protein 1 subunit beta OS=Rattus norvegicus GN=Cct2 PE=1 SV=3 3 527 0.0E+00
sp|Q3ZBH0|TCPB_BOVIN T-complex protein 1 subunit beta OS=Bos taurus GN=CCT2 PE=1 SV=3 3 527 0.0E+00
sp|P80314|TCPB_MOUSE T-complex protein 1 subunit beta OS=Mus musculus GN=Cct2 PE=1 SV=4 3 527 0.0E+00
sp|Q4R6F8|TCPB_MACFA T-complex protein 1 subunit beta OS=Macaca fascicularis GN=CCT2 PE=2 SV=3 3 527 0.0E+00
sp|P78371|TCPB_HUMAN T-complex protein 1 subunit beta OS=Homo sapiens GN=CCT2 PE=1 SV=4 3 527 0.0E+00
sp|Q54ES9|TCPB_DICDI T-complex protein 1 subunit beta OS=Dictyostelium discoideum GN=cct2 PE=1 SV=1 2 530 0.0E+00
sp|Q940P8|TCPB_ARATH T-complex protein 1 subunit beta OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 8 530 0.0E+00
sp|P47207|TCPB_CAEEL T-complex protein 1 subunit beta OS=Caenorhabditis elegans GN=cct-2 PE=1 SV=2 6 527 0.0E+00
sp|Q8SQP2|TCPB_ENCCU T-complex protein 1 subunit beta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT2 PE=1 SV=1 13 529 3.0E-146
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 6 522 3.0E-104
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 2 524 3.0E-98
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 19 515 4.0E-97
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 5 522 1.0E-96
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 6 525 4.0E-96
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 6 525 5.0E-96
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 6 525 2.0E-95
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 1 522 6.0E-95
sp|O24735|THSB_SULTO Thermosome subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsB PE=1 SV=1 6 522 5.0E-94
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 1 520 1.0E-92
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 1 524 2.0E-92
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 6 529 3.0E-92
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 1 522 5.0E-92
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 5 522 5.0E-91
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 1 520 8.0E-91
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 5 522 9.0E-91
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 9 522 4.0E-90
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 5 529 5.0E-90
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 1 522 1.0E-89
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 5 529 2.0E-89
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 6 523 1.0E-88
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 3 528 3.0E-88
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 3 528 3.0E-88
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 5 529 4.0E-88
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 5 522 4.0E-88
sp|Q54ER7|TCPH_DICDI T-complex protein 1 subunit eta OS=Dictyostelium discoideum GN=cct7 PE=3 SV=1 6 521 1.0E-87
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 6 524 5.0E-86
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 6 522 8.0E-86
sp|Q9SF16|TCPH_ARATH T-complex protein 1 subunit eta OS=Arabidopsis thaliana GN=CCT7 PE=1 SV=1 1 521 8.0E-86
sp|O30561|THS1_HALVD Thermosome subunit 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct1 PE=1 SV=1 1 522 2.0E-85
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 5 529 3.0E-85
sp|P28769|TCPA_ARATH T-complex protein 1 subunit alpha OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 16 521 4.0E-85
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 3 528 1.0E-84
sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens GN=TCP1 PE=1 SV=1 6 528 8.0E-84
sp|P18279|TCPA_CRIGR T-complex protein 1 subunit alpha OS=Cricetulus griseus GN=TCP1 PE=2 SV=1 6 528 1.0E-83
sp|Q32L40|TCPA_BOVIN T-complex protein 1 subunit alpha OS=Bos taurus GN=TCP1 PE=1 SV=1 6 528 2.0E-83
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 6 525 3.0E-83
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 6 529 5.0E-83
sp|Q9XT06|TCPA_MONDO T-complex protein 1 subunit alpha OS=Monodelphis domestica GN=TCP1 PE=2 SV=1 6 528 5.0E-83
sp|O77323|TCPH_PLAF7 T-complex protein 1 subunit eta OS=Plasmodium falciparum (isolate 3D7) GN=MAL3P3.6 PE=3 SV=1 6 521 5.0E-83
sp|Q99832|TCPH_HUMAN T-complex protein 1 subunit eta OS=Homo sapiens GN=CCT7 PE=1 SV=2 6 525 5.0E-83
sp|O15891|TCPA_TETPY T-complex protein 1 subunit alpha OS=Tetrahymena pyriformis PE=3 SV=1 16 528 5.0E-83
sp|Q5R5C8|TCPH_PONAB T-complex protein 1 subunit eta OS=Pongo abelii GN=CCT7 PE=2 SV=1 6 525 1.0E-82
sp|Q4R5G2|TCPA_MACFA T-complex protein 1 subunit alpha OS=Macaca fascicularis GN=TCP1 PE=2 SV=1 6 528 4.0E-82
sp|Q94757|TCPA_SCHMA T-complex protein 1 subunit alpha OS=Schistosoma mansoni GN=TCP-1A PE=2 SV=1 13 527 4.0E-82
sp|P80313|TCPH_MOUSE T-complex protein 1 subunit eta OS=Mus musculus GN=Cct7 PE=1 SV=1 6 525 4.0E-82
sp|Q2NKZ1|TCPH_BOVIN T-complex protein 1 subunit eta OS=Bos taurus GN=CCT7 PE=1 SV=1 6 525 6.0E-82
sp|P11983|TCPA_MOUSE T-complex protein 1 subunit alpha OS=Mus musculus GN=Tcp1 PE=1 SV=3 6 528 1.0E-81
sp|P28480|TCPA_RAT T-complex protein 1 subunit alpha OS=Rattus norvegicus GN=Tcp1 PE=1 SV=1 6 528 3.0E-81
sp|P41988|TCPA_CAEEL T-complex protein 1 subunit alpha OS=Caenorhabditis elegans GN=cct-1 PE=3 SV=2 19 521 2.0E-80
sp|P12613|TCPA_DROME T-complex protein 1 subunit alpha OS=Drosophila melanogaster GN=T-cp1 PE=2 SV=2 15 527 2.0E-80
sp|Q9UTM4|TCPE_SCHPO T-complex protein 1 subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct5 PE=3 SV=1 33 525 7.0E-80
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 9 520 2.0E-79
sp|Q9W790|TCPA_PALPA T-complex protein 1 subunit alpha OS=Paleosuchus palpebrosus GN=TCP1 PE=2 SV=1 1 528 4.0E-79
sp|P47209|TCPE_CAEEL T-complex protein 1 subunit epsilon OS=Caenorhabditis elegans GN=cct-5 PE=2 SV=1 3 519 1.0E-78
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 9 520 5.0E-78
sp|O94501|TCPA_SCHPO T-complex protein 1 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct1 PE=3 SV=1 19 527 3.0E-77
sp|Q9HN70|THSA_HALSA Thermosome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsA PE=3 SV=2 5 522 3.0E-77
sp|P12612|TCPA_YEAST T-complex protein 1 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCP1 PE=1 SV=2 19 524 1.0E-76
sp|P40413|TCPE_YEAST T-complex protein 1 subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT5 PE=1 SV=3 16 520 2.0E-76
sp|O04450|TCPE_ARATH T-complex protein 1 subunit epsilon OS=Arabidopsis thaliana GN=CCT5 PE=1 SV=1 15 520 2.0E-76
sp|Q55BM4|TCPA_DICDI T-complex protein 1 subunit alpha OS=Dictyostelium discoideum GN=tcp1 PE=2 SV=1 19 528 6.0E-76
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 9 520 2.0E-75
sp|P54409|TCPH_TETPY T-complex protein 1 subunit eta OS=Tetrahymena pyriformis PE=3 SV=1 4 521 2.0E-74
sp|P50999|TCPD_SCHPO T-complex protein 1 subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct4 PE=2 SV=2 16 519 2.0E-74
sp|P54411|TCPE2_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 4 520 4.0E-74
sp|P80316|TCPE_MOUSE T-complex protein 1 subunit epsilon OS=Mus musculus GN=Cct5 PE=1 SV=1 19 519 2.0E-73
sp|P47208|TCPD_CAEEL T-complex protein 1 subunit delta OS=Caenorhabditis elegans GN=cct-4 PE=2 SV=1 16 522 3.0E-73
sp|Q4R6V2|TCPE_MACFA T-complex protein 1 subunit epsilon OS=Macaca fascicularis GN=CCT5 PE=2 SV=1 19 519 5.0E-73
sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens GN=CCT5 PE=1 SV=1 19 519 5.0E-73
sp|O30560|THS2_HALVD Thermosome subunit 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct2 PE=1 SV=1 1 522 7.0E-73
sp|Q68FQ0|TCPE_RAT T-complex protein 1 subunit epsilon OS=Rattus norvegicus GN=Cct5 PE=1 SV=1 19 519 1.0E-72
sp|Q9LV21|TCPD_ARATH T-complex protein 1 subunit delta OS=Arabidopsis thaliana GN=CCT4 PE=1 SV=1 11 520 1.0E-72
sp|Q5RF02|TCPE_PONAB T-complex protein 1 subunit epsilon OS=Pongo abelii GN=CCT5 PE=2 SV=1 19 519 4.0E-72
sp|P40412|TCPE1_AVESA T-complex protein 1 subunit epsilon OS=Avena sativa PE=2 SV=1 36 520 9.0E-72
sp|Q6BXF6|TCPD_DEBHA T-complex protein 1 subunit delta OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCT4 PE=3 SV=1 16 519 2.0E-71
sp|Q9NB32|TCPD_OCHTR T-complex protein 1 subunit delta OS=Ochlerotatus triseriatus PE=2 SV=1 16 520 3.0E-71
sp|Q9HNI0|THSB_HALSA Thermosome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thsB PE=3 SV=2 39 522 6.0E-70
sp|Q54TD3|TCPE_DICDI T-complex protein 1 subunit epsilon OS=Dictyostelium discoideum GN=cct5 PE=3 SV=1 18 524 2.0E-69
sp|Q9HHA2|THS3_HALVD Thermosome subunit 3 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=cct3 PE=1 SV=2 5 522 5.0E-69
sp|Q75A36|TCPD_ASHGO T-complex protein 1 subunit delta OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCT4 PE=3 SV=1 15 519 1.0E-68
sp|Q6C100|TCPD_YARLI T-complex protein 1 subunit delta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCT4 PE=3 SV=1 6 519 6.0E-68
sp|Q6FQT2|TCPD_CANGA T-complex protein 1 subunit delta OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCT4 PE=3 SV=1 15 519 7.0E-68
sp|P53451|TCPD_TAKRU T-complex protein 1 subunit delta OS=Takifugu rubripes GN=cct4 PE=2 SV=1 16 522 1.0E-67
sp|Q2T9X2|TCPD_BOVIN T-complex protein 1 subunit delta OS=Bos taurus GN=CCT4 PE=1 SV=3 16 520 2.0E-67
sp|P80315|TCPD_MOUSE T-complex protein 1 subunit delta OS=Mus musculus GN=Cct4 PE=1 SV=3 16 520 3.0E-67
sp|Q8SSC9|TCPA_ENCCU T-complex protein 1 subunit alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TCP1 PE=1 SV=1 33 524 3.0E-67
sp|Q7TPB1|TCPD_RAT T-complex protein 1 subunit delta OS=Rattus norvegicus GN=Cct4 PE=1 SV=3 16 520 3.0E-67
sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens GN=CCT4 PE=1 SV=4 16 520 3.0E-67
sp|Q54CL2|TCPD_DICDI T-complex protein 1 subunit delta OS=Dictyostelium discoideum GN=cct4 PE=3 SV=1 10 522 7.0E-67
sp|Q5R637|TCPD_PONAB T-complex protein 1 subunit delta OS=Pongo abelii GN=CCT4 PE=2 SV=3 16 520 1.0E-66
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 5 526 8.0E-66
sp|Q6CL82|TCPD_KLULA T-complex protein 1 subunit delta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCT4 PE=3 SV=1 15 519 2.0E-65
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 6 526 2.0E-64
sp|P39078|TCPD_YEAST T-complex protein 1 subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT4 PE=1 SV=2 15 519 1.0E-63
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 6 520 2.0E-62
sp|Q8SRP9|TCPE_ENCCU T-complex protein 1 subunit epsilon OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT5 PE=1 SV=1 3 520 1.0E-60
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 5 528 1.0E-60
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 5 527 2.0E-60
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 1 526 3.0E-60
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 1 526 5.0E-60
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 1 526 6.0E-60
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 1 526 3.0E-59
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 1 526 3.0E-58
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 1 526 7.0E-57
sp|Q8L7N0|TCPZB_ARATH T-complex protein 1 subunit zeta 2 OS=Arabidopsis thaliana GN=CCT6B PE=1 SV=1 35 528 5.0E-56
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 33 522 1.0E-55
sp|Q9M888|TCPZA_ARATH T-complex protein 1 subunit zeta 1 OS=Arabidopsis thaliana GN=CCT6A PE=1 SV=1 35 528 1.0E-55
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 15 528 7.0E-55
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 1 520 3.0E-54
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 5 526 1.0E-53
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 6 527 4.0E-53
sp|P54410|TCPH_TETTH T-complex protein 1 subunit eta (Fragment) OS=Tetrahymena thermophila PE=3 SV=1 62 408 5.0E-53
sp|Q5RCD2|TCPZ_PONAB T-complex protein 1 subunit zeta OS=Pongo abelii GN=CCT6 PE=2 SV=3 14 522 9.0E-53
sp|P40227|TCPZ_HUMAN T-complex protein 1 subunit zeta OS=Homo sapiens GN=CCT6A PE=1 SV=3 14 522 3.0E-52
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 28 522 2.0E-51
sp|O77622|TCPZ_RABIT T-complex protein 1 subunit zeta OS=Oryctolagus cuniculus GN=CCT6 PE=1 SV=3 14 522 3.0E-51
sp|Q92526|TCPW_HUMAN T-complex protein 1 subunit zeta-2 OS=Homo sapiens GN=CCT6B PE=1 SV=5 35 522 8.0E-51
sp|P80317|TCPZ_MOUSE T-complex protein 1 subunit zeta OS=Mus musculus GN=Cct6a PE=1 SV=3 14 522 6.0E-50
sp|Q3MHL7|TCPZ_BOVIN T-complex protein 1 subunit zeta OS=Bos taurus GN=CCT6A PE=1 SV=3 14 522 2.0E-49
sp|P46550|TCPZ_CAEEL T-complex protein 1 subunit zeta OS=Caenorhabditis elegans GN=cct-6 PE=1 SV=1 18 522 1.0E-47
sp|Q5ZJ54|TCPZ_CHICK T-complex protein 1 subunit zeta OS=Gallus gallus GN=CCT6 PE=1 SV=3 35 522 1.0E-47
sp|Q3T084|TCPW_BOVIN T-complex protein 1 subunit zeta-2 OS=Bos taurus GN=CCT6B PE=2 SV=3 35 522 2.0E-47
sp|O94515|TCPZ_SCHPO T-complex protein 1 subunit zeta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct6 PE=3 SV=1 30 522 8.0E-47
sp|Q61390|TCPW_MOUSE T-complex protein 1 subunit zeta-2 OS=Mus musculus GN=Cct6b PE=1 SV=4 35 522 8.0E-47
sp|P39079|TCPZ_YEAST T-complex protein 1 subunit zeta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT6 PE=1 SV=1 36 522 1.0E-45
sp|Q76NU3|TCPZ_DICDI T-complex protein 1 subunit zeta OS=Dictyostelium discoideum GN=cct6 PE=1 SV=1 35 523 1.0E-45
sp|Q94K05|TCPQ_ARATH T-complex protein 1 subunit theta OS=Arabidopsis thaliana GN=CCT8 PE=1 SV=1 36 524 3.0E-44
sp|P78921|TCPQ_SCHPO Probable T-complex protein 1 subunit theta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct8 PE=2 SV=3 8 520 5.0E-44
sp|Q552J0|TCPQ_DICDI T-complex protein 1 subunit theta OS=Dictyostelium discoideum GN=cct8 PE=3 SV=1 33 524 6.0E-44
sp|Q6EE31|TCPQ_CHICK T-complex protein 1 subunit theta OS=Gallus gallus GN=CCT8 PE=1 SV=3 8 524 3.0E-43
sp|A8X6I9|TCPQ_CAEBR T-complex protein 1 subunit theta OS=Caenorhabditis briggsae GN=cct-8 PE=3 SV=1 7 527 5.0E-43
sp|Q3ZCI9|TCPQ_BOVIN T-complex protein 1 subunit theta OS=Bos taurus GN=CCT8 PE=1 SV=3 8 524 2.0E-42
sp|P42932|TCPQ_MOUSE T-complex protein 1 subunit theta OS=Mus musculus GN=Cct8 PE=1 SV=3 38 524 7.0E-42
sp|Q5RAP1|TCPQ_PONAB T-complex protein 1 subunit theta OS=Pongo abelii GN=CCT8 PE=2 SV=3 8 524 2.0E-40
sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens GN=CCT8 PE=1 SV=4 8 524 2.0E-40
sp|Q4R5J0|TCPQ_MACFA T-complex protein 1 subunit theta OS=Macaca fascicularis GN=CCT8 PE=2 SV=1 8 524 2.0E-40
sp|P47079|TCPQ_YEAST T-complex protein 1 subunit theta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT8 PE=1 SV=1 9 522 1.0E-38
sp|Q8SSH3|TCPD_ENCCU T-complex protein 1 subunit delta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT4 PE=1 SV=1 17 522 2.0E-35
sp|Q9N358|TCPQ_CAEEL T-complex protein 1 subunit theta OS=Caenorhabditis elegans GN=cct-8 PE=1 SV=3 37 520 3.0E-35
sp|P47828|TCPQ_CANAX T-complex protein 1 subunit theta OS=Candida albicans GN=CCT8 PE=3 SV=2 9 522 6.0E-35
sp|Q96SF2|TCPQM_HUMAN T-complex protein 1 subunit theta-like 2 OS=Homo sapiens GN=CCT8L2 PE=2 SV=2 24 528 1.0E-29
sp|A6NM43|TCPQL_HUMAN Putative T-complex protein 1 subunit theta-like 1 OS=Homo sapiens GN=CCT8L1P PE=5 SV=1 24 522 1.0E-28
sp|P86245|TCPB_MESAU T-complex protein 1 subunit beta (Fragments) OS=Mesocricetus auratus GN=CCT2 PE=1 SV=1 290 387 6.0E-22
sp|P50157|TCPA_AMBME T-complex protein 1 subunit alpha (Fragment) OS=Ambystoma mexicanum PE=2 SV=1 379 529 1.0E-17
sp|Q8SS33|TCPQ_ENCCU T-complex protein 1 subunit theta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT8 PE=1 SV=1 35 440 2.0E-16
sp|A8F401|CH60_PSELT 60 kDa chaperonin OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=groL PE=3 SV=1 20 527 2.0E-16
sp|A0LR17|CH601_ACIC1 60 kDa chaperonin 1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=groL1 PE=3 SV=1 20 526 2.0E-15
sp|Q1AXU6|CH60_RUBXD 60 kDa chaperonin OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=groL PE=3 SV=1 22 528 2.0E-15
sp|Q29068|TCPG_PIG T-complex protein 1 subunit gamma (Fragment) OS=Sus scrofa GN=CCT3 PE=2 SV=1 33 110 4.0E-15
sp|Q4JTF2|CH602_CORJK 60 kDa chaperonin 2 OS=Corynebacterium jeikeium (strain K411) GN=groL2 PE=3 SV=1 29 514 1.0E-14
sp|Q9WYX6|CH60_THEMA 60 kDa chaperonin OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=groL PE=3 SV=1 20 527 1.0E-14
sp|Q93N34|CH60_BUCRP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Rhopalosiphum padi GN=groL PE=3 SV=1 19 526 2.0E-14
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 20 526 2.0E-14
sp|B1L8Y8|CH60_THESQ 60 kDa chaperonin OS=Thermotoga sp. (strain RQ2) GN=groL PE=3 SV=1 20 527 3.0E-14
sp|A5IJR6|CH60_THEP1 60 kDa chaperonin OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=groL PE=3 SV=1 20 527 3.0E-14
sp|Q9AEP7|CH60_LACLM 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=groL PE=3 SV=1 21 216 5.0E-14
sp|Q031S8|CH60_LACLS 60 kDa chaperonin OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=groL PE=3 SV=1 21 216 5.0E-14
sp|P37282|CH60_LACLA 60 kDa chaperonin OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=groL PE=3 SV=2 21 216 5.0E-14
sp|Q9EZV1|CH60_THENE 60 kDa chaperonin OS=Thermotoga neapolitana GN=groL PE=3 SV=1 20 527 5.0E-14
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 20 526 7.0E-14
sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=groL PE=3 SV=2 20 219 8.0E-14
sp|P0CY96|CH60_PROAA 60 kDa chaperonin OS=Propionibacterium acnes GN=groL PE=3 SV=1 22 524 8.0E-14
sp|P0CY97|CH601_PROAC 60 kDa chaperonin 1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=groL1 PE=3 SV=1 22 524 8.0E-14
sp|Q8CX22|CH60_STRA3 60 kDa chaperonin OS=Streptococcus agalactiae serotype III (strain NEM316) GN=groL PE=3 SV=1 21 238 3.0E-13
sp|Q8CX00|CH60_STRA5 60 kDa chaperonin OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=groL PE=3 SV=1 21 238 4.0E-13
sp|Q3JYQ0|CH60_STRA1 60 kDa chaperonin OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=groL PE=3 SV=1 21 238 4.0E-13
sp|Q8VT58|CH60_STRGN 60 kDa chaperonin OS=Streptococcus gordonii GN=groL PE=3 SV=1 21 220 6.0E-13
sp|Q47LP1|CH602_THEFY 60 kDa chaperonin 2 OS=Thermobifida fusca (strain YX) GN=groL2 PE=3 SV=1 20 520 7.0E-13
sp|A8AZE1|CH60_STRGC 60 kDa chaperonin OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=groL PE=3 SV=1 21 220 7.0E-13
sp|Q9KXU5|CH602_STRCO 60 kDa chaperonin 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=groL2 PE=3 SV=1 20 526 8.0E-13
sp|A8FAG3|CH60_BACP2 60 kDa chaperonin OS=Bacillus pumilus (strain SAFR-032) GN=groL PE=3 SV=1 20 140 1.0E-12
sp|B0RAY1|CH60_CLAMS 60 kDa chaperonin OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=groL PE=3 SV=1 20 526 1.0E-12
sp|A5CTX3|CH60_CLAM3 60 kDa chaperonin OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=groL PE=3 SV=1 20 526 1.0E-12
sp|C5BZB0|CH60_BEUC1 60 kDa chaperonin OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=groL PE=3 SV=1 20 526 1.0E-12
sp|Q38YR7|CH60_LACSS 60 kDa chaperonin OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=groL PE=3 SV=1 20 219 1.0E-12
sp|A8YTH8|CH60_LACH4 60 kDa chaperonin OS=Lactobacillus helveticus (strain DPC 4571) GN=groL PE=3 SV=1 20 218 2.0E-12
sp|O50305|CH60_BACHD 60 kDa chaperonin OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=groL PE=2 SV=2 20 138 2.0E-12
sp|O32847|CH60_LACZE 60 kDa chaperonin OS=Lactobacillus zeae GN=groL PE=3 SV=1 20 218 2.0E-12
sp|B3W9W7|CH60_LACCB 60 kDa chaperonin OS=Lactobacillus casei (strain BL23) GN=groL PE=3 SV=1 20 218 2.0E-12
sp|Q035Y9|CH60_LACC3 60 kDa chaperonin OS=Lactobacillus casei (strain ATCC 334) GN=groL PE=3 SV=1 20 218 2.0E-12
sp|A1SNU4|CH602_NOCSJ 60 kDa chaperonin 2 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=groL2 PE=3 SV=1 20 530 3.0E-12
sp|Q82GG6|CH602_STRAW 60 kDa chaperonin 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=groL2 PE=3 SV=1 20 526 4.0E-12
sp|A7Z207|CH60_BACMF 60 kDa chaperonin OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=groL PE=3 SV=1 20 140 4.0E-12
sp|Q8KJ18|CH60_STRCV 60 kDa chaperonin OS=Streptococcus constellatus GN=groL PE=3 SV=1 21 220 4.0E-12
sp|P28598|CH60_BACSU 60 kDa chaperonin OS=Bacillus subtilis (strain 168) GN=groL PE=1 SV=3 20 140 4.0E-12
sp|Q9AME7|CH60_STRAG 60 kDa chaperonin OS=Streptococcus agalactiae GN=groL PE=3 SV=1 21 238 4.0E-12
sp|Q8KJ20|CH60_STRAP 60 kDa chaperonin OS=Streptococcus anginosus GN=groL PE=3 SV=1 21 220 4.0E-12
sp|Q0SET3|CH601_RHOJR 60 kDa chaperonin 1 OS=Rhodococcus jostii (strain RHA1) GN=groL1 PE=3 SV=1 20 526 6.0E-12
sp|O68324|CH60_LACHE 60 kDa chaperonin OS=Lactobacillus helveticus GN=groL PE=3 SV=1 20 218 6.0E-12
sp|Q88YM5|CH60_LACPL 60 kDa chaperonin OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=groL PE=3 SV=1 20 142 6.0E-12
sp|O51832|CH60_BUCMP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Myzus persicae GN=groL PE=3 SV=1 19 526 7.0E-12
sp|Q9KJ23|CH60_LACJO 60 kDa chaperonin OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=groL PE=3 SV=2 20 140 7.0E-12
sp|Q65MZ8|CH60_BACLD 60 kDa chaperonin OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=groL PE=3 SV=1 20 140 7.0E-12
sp|Q5WJN4|CH60_BACSK 60 kDa chaperonin OS=Bacillus clausii (strain KSM-K16) GN=groL PE=3 SV=1 20 139 7.0E-12
sp|Q045Q8|CH60_LACGA 60 kDa chaperonin OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=groL PE=3 SV=1 20 140 1.0E-11
sp|Q93G07|CH60_LACAC 60 kDa chaperonin OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=groL PE=3 SV=2 20 140 1.0E-11
sp|Q8KIX0|CH60_BUCCM 60 kDa chaperonin OS=Buchnera aphidicola subsp. Chaetophorus leucomelas GN=groL PE=3 SV=1 19 526 1.0E-11
sp|P42384|CH602_MYCPA 60 kDa chaperonin 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=groL2 PE=3 SV=4 20 526 1.0E-11
sp|A0QLP6|CH602_MYCA1 60 kDa chaperonin 2 OS=Mycobacterium avium (strain 104) GN=groL2 PE=3 SV=1 20 526 1.0E-11
sp|Q59177|CH60_BUCAP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=groL PE=3 SV=3 19 526 1.0E-11
sp|Q29236|TCPZ_PIG T-complex protein 1 subunit zeta (Fragment) OS=Sus scrofa GN=CCT6 PE=2 SV=1 35 123 1.0E-11
sp|Q1WSW0|CH60_LACS1 60 kDa chaperonin OS=Lactobacillus salivarius (strain UCC118) GN=groL PE=3 SV=1 20 219 1.0E-11
sp|B9DW28|CH60_STRU0 60 kDa chaperonin OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=groL PE=3 SV=1 21 238 1.0E-11
sp|Q95058|CH60_TRIVA Hydrogenosomal chaperonin HSP60 OS=Trichomonas vaginalis GN=HSP60 PE=3 SV=1 7 243 2.0E-11
sp|Q8CXQ7|CH60_MYCPE 60 kDa chaperonin OS=Mycoplasma penetrans (strain HF-2) GN=groL PE=3 SV=1 20 520 2.0E-11
sp|Q2JAZ7|CH602_FRASC 60 kDa chaperonin 2 OS=Frankia sp. (strain CcI3) GN=groL2 PE=3 SV=1 37 528 2.0E-11
sp|A9WMA0|CH601_RENSM 60 kDa chaperonin 1 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=groL1 PE=3 SV=2 20 526 2.0E-11
sp|Q93GT8|CH60_COLMA 60 kDa chaperonin OS=Colwellia maris GN=groL PE=3 SV=2 19 150 3.0E-11
sp|B2GAI0|CH60_LACF3 60 kDa chaperonin OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=groL PE=3 SV=1 20 219 3.0E-11
sp|A1SMW1|CH601_NOCSJ 60 kDa chaperonin 1 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=groL1 PE=3 SV=1 20 230 3.0E-11
sp|C0MES3|CH60_STRS7 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 20 139 4.0E-11
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 20 139 4.0E-11
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 20 139 4.0E-11
sp|Q03SQ9|CH60_LACBA 60 kDa chaperonin OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=groL PE=3 SV=1 20 167 4.0E-11
sp|Q93GT6|CH60_TETHA 60 kDa chaperonin OS=Tetragenococcus halophilus GN=groL PE=3 SV=2 20 139 4.0E-11
sp|Q48R03|CH60_STRPM 60 kDa chaperonin OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|Q1J4D1|CH60_STRPF 60 kDa chaperonin OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|Q1JJL5|CH60_STRPC 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|Q1J9G4|CH60_STRPB 60 kDa chaperonin OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 20 139 4.0E-11
sp|P0DA23|CH60_STRPQ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|P0DA22|CH60_STRP3 60 kDa chaperonin OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|B5XIW7|CH60_STRPZ 60 kDa chaperonin OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=groL PE=3 SV=1 21 220 4.0E-11
sp|A0JT07|CH601_ARTS2 60 kDa chaperonin 1 OS=Arthrobacter sp. (strain FB24) GN=groL1 PE=3 SV=1 20 526 5.0E-11
sp|A2RGR1|CH60_STRPG 60 kDa chaperonin OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=groL PE=3 SV=1 21 220 5.0E-11
sp|Q5X9L8|CH60_STRP6 60 kDa chaperonin OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=groL PE=1 SV=3 21 220 5.0E-11
sp|P69883|CH60_STRP1 60 kDa chaperonin OS=Streptococcus pyogenes serotype M1 GN=groL PE=3 SV=2 21 220 5.0E-11
sp|Q1JEL5|CH60_STRPD 60 kDa chaperonin OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=groL PE=3 SV=1 21 220 5.0E-11
sp|B2G5X7|CH60_LACRJ 60 kDa chaperonin OS=Lactobacillus reuteri (strain JCM 1112) GN=groL PE=3 SV=1 20 144 5.0E-11
sp|A5VIE9|CH60_LACRD 60 kDa chaperonin OS=Lactobacillus reuteri (strain DSM 20016) GN=groL PE=3 SV=1 20 144 5.0E-11
sp|Q8NZ56|CH60_STRP8 60 kDa chaperonin OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=groL PE=3 SV=3 21 220 5.0E-11
sp|P95678|CH60_RHOCA 60 kDa chaperonin OS=Rhodobacter capsulatus GN=groL PE=1 SV=1 21 527 5.0E-11
sp|P48212|CH60_CLOTH 60 kDa chaperonin OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=groL PE=1 SV=3 19 221 6.0E-11
sp|B1YEP6|CH60_EXIS2 60 kDa chaperonin OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=groL PE=3 SV=1 20 139 7.0E-11
sp|B5Y894|CH60_COPPD 60 kDa chaperonin OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=groL PE=3 SV=1 20 526 8.0E-11
sp|B7H4Q7|CH60_BACC4 60 kDa chaperonin OS=Bacillus cereus (strain B4264) GN=groL PE=3 SV=1 20 139 8.0E-11
sp|Q814B0|CH60_BACCR 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=groL PE=3 SV=1 20 139 8.0E-11
sp|B7IUT0|CH60_BACC2 60 kDa chaperonin OS=Bacillus cereus (strain G9842) GN=groL PE=3 SV=1 20 139 8.0E-11
sp|B4U081|CH60_STREM 60 kDa chaperonin OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=groL PE=3 SV=1 21 220 8.0E-11
sp|Q4MPR6|CH60_BACCE 60 kDa chaperonin OS=Bacillus cereus GN=groL PE=1 SV=3 20 139 8.0E-11
sp|Q8TGX7|CH60_METAC 60 kDa chaperonin OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=groL PE=3 SV=1 20 144 8.0E-11
sp|A9VQG8|CH60_BACWK 60 kDa chaperonin OS=Bacillus weihenstephanensis (strain KBAB4) GN=groL PE=3 SV=1 20 139 9.0E-11
sp|C0M7S3|CH60_STRE4 60 kDa chaperonin OS=Streptococcus equi subsp. equi (strain 4047) GN=groL PE=3 SV=1 21 220 9.0E-11
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 20 139 9.0E-11
sp|Q03H05|CH60_PEDPA 60 kDa chaperonin OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=groL PE=3 SV=1 20 140 1.0E-10
sp|A4XBH2|CH602_SALTO 60 kDa chaperonin 2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=groL2 PE=3 SV=1 29 528 1.0E-10
sp|Q2IZ16|CH601_RHOP2 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=groL1 PE=3 SV=1 19 142 1.0E-10
sp|B2UZ02|CH60_CLOBA 60 kDa chaperonin OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=groL PE=3 SV=1 19 140 1.0E-10
sp|B2TIX0|CH60_CLOBB 60 kDa chaperonin OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=groL PE=3 SV=1 19 140 1.0E-10
sp|Q1GRD4|CH602_SPHAL 60 kDa chaperonin 2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=groL2 PE=3 SV=1 21 149 1.0E-10
sp|A4FPA5|CH602_SACEN 60 kDa chaperonin 2 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=groL2 PE=3 SV=1 20 236 1.0E-10
sp|C4L1L2|CH60_EXISA 60 kDa chaperonin OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=groL PE=3 SV=1 20 139 1.0E-10
sp|Q04E64|CH60_OENOB 60 kDa chaperonin OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=groL PE=3 SV=1 20 219 1.0E-10
sp|Q8KTS0|CH60_TREPR 60 kDa chaperonin OS=Tremblaya princeps GN=groL PE=3 SV=1 19 140 1.0E-10
sp|Q8CXL3|CH60_OCEIH 60 kDa chaperonin OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=groL PE=3 SV=1 20 139 1.0E-10
sp|A0LRS7|CH602_ACIC1 60 kDa chaperonin 2 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=groL2 PE=3 SV=1 20 230 2.0E-10
sp|A9GBQ2|CH602_SORC5 60 kDa chaperonin 2 OS=Sorangium cellulosum (strain So ce56) GN=groL2 PE=3 SV=1 20 142 2.0E-10
sp|B2FIU9|CH60_STRMK 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain K279a) GN=groL PE=3 SV=1 19 220 2.0E-10
sp|C1CTD6|CH60_STRZT 60 kDa chaperonin OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|C1CGD7|CH60_STRZJ 60 kDa chaperonin OS=Streptococcus pneumoniae (strain JJA) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|P0A336|CH60_STRR6 60 kDa chaperonin OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|P0A335|CH60_STRPN 60 kDa chaperonin OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=groL PE=1 SV=1 21 238 2.0E-10
sp|B8ZNK9|CH60_STRPJ 60 kDa chaperonin OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|C1C9H6|CH60_STRP7 60 kDa chaperonin OS=Streptococcus pneumoniae (strain 70585) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|B5E223|CH60_STRP4 60 kDa chaperonin OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|Q04IQ3|CH60_STRP2 60 kDa chaperonin OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|Q8KJ24|CH60_CLOBO 60 kDa chaperonin OS=Clostridium botulinum GN=groL PE=3 SV=1 19 142 2.0E-10
sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin OS=Bacillus cereus (strain ZK / E33L) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|B9J1H2|CH60_BACCQ 60 kDa chaperonin OS=Bacillus cereus (strain Q1) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|B7HS05|CH60_BACC7 60 kDa chaperonin OS=Bacillus cereus (strain AH187) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|C1EUB1|CH60_BACC3 60 kDa chaperonin OS=Bacillus cereus (strain 03BB102) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|Q73ER9|CH60_BACC1 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=groL PE=3 SV=2 20 139 2.0E-10
sp|B7JM60|CH60_BACC0 60 kDa chaperonin OS=Bacillus cereus (strain AH820) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|A0R8W4|CH60_BACAH 60 kDa chaperonin OS=Bacillus thuringiensis (strain Al Hakam) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|Q81VE1|CH60_BACAN 60 kDa chaperonin OS=Bacillus anthracis GN=groL PE=3 SV=1 20 139 2.0E-10
sp|C3L507|CH60_BACAC 60 kDa chaperonin OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|C3PAV1|CH60_BACAA 60 kDa chaperonin OS=Bacillus anthracis (strain A0248) GN=groL PE=3 SV=1 20 139 2.0E-10
sp|B2ILZ5|CH60_STRPS 60 kDa chaperonin OS=Streptococcus pneumoniae (strain CGSP14) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|B1I8B2|CH60_STRPI 60 kDa chaperonin OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|Q891G4|CH60_CLOTE 60 kDa chaperonin OS=Clostridium tetani (strain Massachusetts / E88) GN=groL PE=3 SV=1 19 140 2.0E-10
sp|C1CML7|CH60_STRZP 60 kDa chaperonin OS=Streptococcus pneumoniae (strain P1031) GN=groL PE=3 SV=1 21 238 2.0E-10
sp|A1R3H9|CH601_ARTAT 60 kDa chaperonin 1 OS=Arthrobacter aurescens (strain TC1) GN=groL1 PE=3 SV=1 20 526 2.0E-10
sp|B0CFQ6|CH601_ACAM1 60 kDa chaperonin 1 OS=Acaryochloris marina (strain MBIC 11017) GN=groL1 PE=3 SV=1 20 243 2.0E-10
sp|A8ERY3|CH60_ARCB4 60 kDa chaperonin OS=Arcobacter butzleri (strain RM4018) GN=groL PE=3 SV=1 20 218 2.0E-10
sp|B1ZAU5|CH60_METPB 60 kDa chaperonin OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=groL PE=3 SV=1 21 136 2.0E-10
sp|Q6NF74|CH602_CORDI 60 kDa chaperonin 2 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=groL2 PE=3 SV=1 20 142 2.0E-10
sp|Q00768|CH602_STRAL 60 kDa chaperonin 2 OS=Streptomyces albus G GN=groL2 PE=1 SV=3 20 144 2.0E-10
sp|Q0RQ25|CH602_FRAAA 60 kDa chaperonin 2 OS=Frankia alni (strain ACN14a) GN=groL2 PE=3 SV=1 20 524 3.0E-10
sp|P59526|CH60_BUCBP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=groL PE=3 SV=1 19 525 3.0E-10
sp|A1T577|CH602_MYCVP 60 kDa chaperonin 2 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=groL2 PE=3 SV=1 17 528 3.0E-10
sp|P9WPE7|CH602_MYCTU 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=groEL2 PE=1 SV=1 20 526 3.0E-10
sp|P9WPE6|CH602_MYCTO 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=groEL2 PE=3 SV=1 20 526 3.0E-10
sp|P0A521|CH602_MYCBO 60 kDa chaperonin 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=groL2 PE=1 SV=2 20 526 3.0E-10
sp|A5TZG6|CH601_MYCTA 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=groL1 PE=3 SV=1 20 526 3.0E-10
sp|A1KFR2|CH601_MYCBP 60 kDa chaperonin 1 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=groL1 PE=3 SV=1 20 526 3.0E-10
sp|Q487Q9|CH60_COLP3 60 kDa chaperonin OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=groL PE=3 SV=1 19 150 3.0E-10
sp|Q1H4F2|CH60_METFK 60 kDa chaperonin OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=groL PE=3 SV=1 19 526 3.0E-10
sp|A0Q2T1|CH60_CLONN 60 kDa chaperonin OS=Clostridium novyi (strain NT) GN=groL PE=3 SV=1 19 142 3.0E-10
sp|A4T2X3|CH601_MYCGI 60 kDa chaperonin 1 OS=Mycobacterium gilvum (strain PYR-GCK) GN=groL1 PE=3 SV=1 20 526 3.0E-10
sp|Q8PPZ1|CH60_XANAC 60 kDa chaperonin OS=Xanthomonas axonopodis pv. citri (strain 306) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|Q31IT1|CH60_THICR 60 kDa chaperonin OS=Thiomicrospira crunogena (strain XCL-2) GN=groL PE=3 SV=1 19 220 4.0E-10
sp|Q3BY61|CH60_XANC5 60 kDa chaperonin OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|A7GKG0|CH60_BACCN 60 kDa chaperonin OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=groL PE=3 SV=1 20 139 4.0E-10
sp|Q8RIT7|CH60_XANCH 60 kDa chaperonin OS=Xanthomonas campestris pv. phaseoli GN=groL PE=3 SV=1 19 161 4.0E-10
sp|B1LVA0|CH60_METRJ 60 kDa chaperonin OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=groL PE=3 SV=1 21 136 4.0E-10
sp|P34940|CH60_PLAFG Chaperonin CPN60, mitochondrial OS=Plasmodium falciparum (isolate FCR-3 / Gambia) PE=3 SV=1 19 139 4.0E-10
sp|Q46CA1|CH60_METBF 60 kDa chaperonin OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=groL PE=3 SV=1 20 187 4.0E-10
sp|Q058F3|CH60_BUCCC 60 kDa chaperonin OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=groL PE=3 SV=1 19 525 4.0E-10
sp|Q9AFA5|CH60_TSUPA 60 kDa chaperonin OS=Tsukamurella paurometabola GN=groL PE=3 SV=1 20 526 4.0E-10
sp|Q5GUT1|CH60_XANOR 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|B2SJG4|CH60_XANOP 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|Q2NY29|CH60_XANOM 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|Q2NIM6|CH60_AYWBP 60 kDa chaperonin OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=groL PE=3 SV=1 19 131 4.0E-10
sp|Q8PD23|CH60_XANCP 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|Q4UZA7|CH60_XANC8 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain 8004) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|B0RN52|CH60_XANCB 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain B100) GN=groL PE=3 SV=1 19 161 4.0E-10
sp|Q3A0V2|CH60_PELCD 60 kDa chaperonin OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=groL PE=3 SV=1 19 140 4.0E-10
sp|A0JYZ5|CH602_ARTS2 60 kDa chaperonin 2 OS=Arthrobacter sp. (strain FB24) GN=groL2 PE=3 SV=1 33 236 5.0E-10
sp|Q93N35|CH60_BUCRM 60 kDa chaperonin OS=Buchnera aphidicola subsp. Rhopalosiphum maidis GN=groL PE=3 SV=1 19 238 5.0E-10
sp|Q8PW06|CH60_METMA 60 kDa chaperonin OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=groL PE=3 SV=1 20 144 5.0E-10
sp|A0PNL7|CH602_MYCUA 60 kDa chaperonin 2 OS=Mycobacterium ulcerans (strain Agy99) GN=groL2 PE=3 SV=1 20 526 5.0E-10
sp|O33500|CH60_PSEST 60 kDa chaperonin OS=Pseudomonas stutzeri GN=groL PE=3 SV=1 19 161 5.0E-10
sp|A9NHL6|CH60_ACHLI 60 kDa chaperonin OS=Acholeplasma laidlawii (strain PG-8A) GN=groL PE=3 SV=1 19 243 5.0E-10
sp|A5CZ03|CH60_PELTS 60 kDa chaperonin OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=groL PE=3 SV=1 20 142 5.0E-10
sp|A4VP82|CH60_PSEU5 60 kDa chaperonin OS=Pseudomonas stutzeri (strain A1501) GN=groL PE=3 SV=1 19 145 5.0E-10
sp|B0K3P6|CH60_THEPX 60 kDa chaperonin OS=Thermoanaerobacter sp. (strain X514) GN=groL PE=3 SV=1 19 139 5.0E-10
sp|B0KBR3|CH60_THEP3 60 kDa chaperonin OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=groL PE=3 SV=1 19 139 5.0E-10
sp|Q6MRI1|CH60_BDEBA 60 kDa chaperonin OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=groL PE=3 SV=1 20 126 6.0E-10
sp|O33658|CH602_STRLI 60 kDa chaperonin 2 OS=Streptomyces lividans GN=groL2 PE=3 SV=3 20 144 6.0E-10
sp|Q2J4P8|CH604_FRASC 60 kDa chaperonin 4 OS=Frankia sp. (strain CcI3) GN=groL4 PE=3 SV=1 20 526 6.0E-10
sp|C3KUC8|CH60_CLOB6 60 kDa chaperonin OS=Clostridium botulinum (strain 657 / Type Ba4) GN=groL PE=3 SV=1 19 526 6.0E-10
sp|P0C0N7|CH60_STAES 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=groL PE=3 SV=2 20 140 6.0E-10
sp|Q5HMZ1|CH60_STAEQ 60 kDa chaperonin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=groL PE=3 SV=1 20 140 6.0E-10
sp|P0C0N6|CH60_STAEP 60 kDa chaperonin OS=Staphylococcus epidermidis GN=groL PE=3 SV=2 20 140 6.0E-10
sp|A7GIN3|CH60_CLOBL 60 kDa chaperonin OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=groL PE=3 SV=1 19 526 7.0E-10
sp|B1IFD4|CH60_CLOBK 60 kDa chaperonin OS=Clostridium botulinum (strain Okra / Type B1) GN=groL PE=3 SV=1 19 526 7.0E-10
sp|C1FLV5|CH60_CLOBJ 60 kDa chaperonin OS=Clostridium botulinum (strain Kyoto / Type A2) GN=groL PE=3 SV=1 19 526 7.0E-10
sp|A5I723|CH60_CLOBH 60 kDa chaperonin OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=groL PE=3 SV=1 19 526 7.0E-10
sp|A7FYP3|CH60_CLOB1 60 kDa chaperonin OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=groL PE=3 SV=1 19 526 7.0E-10
sp|A8F2B5|CH60_RICM5 60 kDa chaperonin OS=Rickettsia massiliae (strain Mtu5) GN=groL PE=3 SV=2 19 142 7.0E-10
sp|Q03VC3|CH60_LEUMM 60 kDa chaperonin OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=groL PE=3 SV=1 20 148 7.0E-10
sp|A1T352|CH601_MYCVP 60 kDa chaperonin 1 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=groL1 PE=3 SV=1 20 526 7.0E-10
sp|Q9KI57|CH60_GARVA 60 kDa chaperonin OS=Gardnerella vaginalis GN=groL PE=3 SV=2 20 144 7.0E-10
sp|Q3SPG4|CH603_NITWN 60 kDa chaperonin 3 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL3 PE=3 SV=1 21 218 8.0E-10
sp|A5V0S2|CH602_ROSS1 60 kDa chaperonin 2 OS=Roseiflexus sp. (strain RS-1) GN=groL2 PE=3 SV=1 20 143 8.0E-10
sp|B4SKL8|CH60_STRM5 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 19 223 8.0E-10
sp|O66222|CH60_ERWAP 60 kDa chaperonin (Fragment) OS=Erwinia aphidicola GN=groL PE=3 SV=1 19 525 8.0E-10
sp|A6LQ87|CH60_CLOB8 60 kDa chaperonin OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=groL PE=3 SV=1 19 140 9.0E-10
sp|Q3K7L6|CH60_PSEPF 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf0-1) GN=groL PE=3 SV=1 19 144 9.0E-10
sp|Q8CWW6|CH60_STRMU 60 kDa chaperonin OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=groL PE=3 SV=1 21 220 9.0E-10
sp|Q6YR94|CH60_ONYPE 60 kDa chaperonin OS=Onion yellows phytoplasma (strain OY-M) GN=groL PE=3 SV=1 19 243 1.0E-09
sp|Q0TN27|CH60_CLOP1 60 kDa chaperonin OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=groL PE=3 SV=1 19 140 1.0E-09
sp|P26821|CH60_CLOPE 60 kDa chaperonin OS=Clostridium perfringens (strain 13 / Type A) GN=groL PE=3 SV=2 19 140 1.0E-09
sp|Q8GBB4|CH60_AZOVI 60 kDa chaperonin OS=Azotobacter vinelandii GN=groL PE=3 SV=1 19 144 1.0E-09
sp|P35471|CH605_RHIME 60 kDa chaperonin 5 OS=Rhizobium meliloti (strain 1021) GN=groL5 PE=2 SV=2 21 236 1.0E-09
sp|Q9JI70|MKKS_MOUSE McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin OS=Mus musculus GN=Mkks PE=2 SV=2 5 452 1.0E-09
sp|P30717|CH60_CLOAB 60 kDa chaperonin OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=groL PE=3 SV=1 19 140 1.0E-09
sp|Q9KI71|CH60_PARDN 60 kDa chaperonin OS=Parascardovia denticolens GN=groL PE=3 SV=2 20 142 1.0E-09
sp|B8D6T6|CH60_BUCAT 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=groL PE=3 SV=1 19 526 1.0E-09
sp|Q3M1B1|CH603_ANAVT 60 kDa chaperonin 3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=groL3 PE=3 SV=1 20 527 1.0E-09
sp|C5BP08|CH60_TERTT 60 kDa chaperonin OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=groL PE=3 SV=1 19 142 1.0E-09
sp|A1R8M1|CH602_ARTAT 60 kDa chaperonin 2 OS=Arthrobacter aurescens (strain TC1) GN=groL2 PE=3 SV=1 22 236 1.0E-09
sp|B8I5W0|CH60_CLOCE 60 kDa chaperonin OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=groL PE=3 SV=1 19 142 1.0E-09
sp|A4F749|CH601_SACEN 60 kDa chaperonin 1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=groL1 PE=3 SV=1 20 142 1.0E-09
sp|A7I798|CH60_METB6 60 kDa chaperonin OS=Methanoregula boonei (strain 6A8) GN=groL PE=3 SV=1 20 143 1.0E-09
sp|P69205|CH60_TROWT 60 kDa chaperonin OS=Tropheryma whipplei (strain Twist) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|P69204|CH60_TROWH 60 kDa chaperonin OS=Tropheryma whipplei GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q08854|CH60_STAAU 60 kDa chaperonin OS=Staphylococcus aureus GN=groL PE=1 SV=3 20 142 1.0E-09
sp|P25750|CH60_BUCAI 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=groL PE=3 SV=1 19 526 1.0E-09
sp|B8D8I2|CH60_BUCA5 60 kDa chaperonin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=groL PE=3 SV=1 19 526 1.0E-09
sp|B8GL19|CH60_THISH 60 kDa chaperonin OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=groL PE=3 SV=1 20 526 1.0E-09
sp|Q1BEF6|CH601_MYCSS 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain MCS) GN=groL1 PE=3 SV=2 20 245 1.0E-09
sp|A1UAH8|CH601_MYCSK 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain KMS) GN=groL1 PE=3 SV=1 20 245 1.0E-09
sp|A3PU33|CH601_MYCSJ 60 kDa chaperonin 1 OS=Mycobacterium sp. (strain JLS) GN=groL1 PE=3 SV=1 20 245 1.0E-09
sp|A7NIK8|CH601_ROSCS 60 kDa chaperonin 1 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=groL1 PE=3 SV=1 20 143 1.0E-09
sp|Q2FWN4|CH60_STAA8 60 kDa chaperonin OS=Staphylococcus aureus (strain NCTC 8325) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q83NN0|CH60_TROW8 60 kDa chaperonin OS=Tropheryma whipplei (strain TW08/27) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q048Y3|CH60_LACDB 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q1G937|CH60_LACDA 60 kDa chaperonin OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|P63767|CH60_STAAW 60 kDa chaperonin OS=Staphylococcus aureus (strain MW2) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q6G7S8|CH60_STAAS 60 kDa chaperonin OS=Staphylococcus aureus (strain MSSA476) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|P99083|CH60_STAAN 60 kDa chaperonin OS=Staphylococcus aureus (strain N315) GN=groL PE=1 SV=1 20 142 1.0E-09
sp|P63766|CH60_STAAM 60 kDa chaperonin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|A5IUH6|CH60_STAA9 60 kDa chaperonin OS=Staphylococcus aureus (strain JH9) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|A6U3B5|CH60_STAA2 60 kDa chaperonin OS=Staphylococcus aureus (strain JH1) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|A7X4J1|CH60_STAA1 60 kDa chaperonin OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q8R5X7|CH60_FUSNN 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|B1L1K0|CH60_CLOBM 60 kDa chaperonin OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=groL PE=3 SV=1 19 526 1.0E-09
sp|A8Z4T2|CH60_STAAT 60 kDa chaperonin OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|A6QIM7|CH60_STAAE 60 kDa chaperonin OS=Staphylococcus aureus (strain Newman) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q5HEH2|CH60_STAAC 60 kDa chaperonin OS=Staphylococcus aureus (strain COL) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q2FF95|CH60_STAA3 60 kDa chaperonin OS=Staphylococcus aureus (strain USA300) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q6GF43|CH60_STAAR 60 kDa chaperonin OS=Staphylococcus aureus (strain MRSA252) GN=groL PE=3 SV=1 20 142 1.0E-09
sp|Q2YUD8|CH60_STAAB 60 kDa chaperonin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=groL PE=3 SV=1 20 142 2.0E-09
sp|P18687|CH60_CRIGR 60 kDa heat shock protein, mitochondrial OS=Cricetulus griseus GN=HSPD1 PE=2 SV=1 19 528 2.0E-09
sp|A4QHB7|CH602_CORGB 60 kDa chaperonin 2 OS=Corynebacterium glutamicum (strain R) GN=groL2 PE=3 SV=1 20 142 2.0E-09
sp|Q9AFA6|CH602_NOCFA 60 kDa chaperonin 2 OS=Nocardia farcinica (strain IFM 10152) GN=groL2 PE=3 SV=2 20 526 2.0E-09
sp|A6WE60|CH602_KINRD 60 kDa chaperonin 2 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=groL2 PE=3 SV=1 20 245 2.0E-09
sp|A9BHK4|CH60_PETMO 60 kDa chaperonin OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=groL PE=3 SV=1 20 520 2.0E-09
sp|Q2IFK0|CH602_ANADE 60 kDa chaperonin 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=groL2 PE=3 SV=1 20 149 2.0E-09
sp|Q87JG6|CH602_VIBPA 60 kDa chaperonin 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=groL2 PE=3 SV=1 21 140 2.0E-09
sp|Q8CY22|CH602_COREF 60 kDa chaperonin 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=groL2 PE=3 SV=1 20 142 2.0E-09
sp|Q93M78|CH60_BIFAS 60 kDa chaperonin OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=groL PE=3 SV=2 17 142 2.0E-09
sp|B8DTZ2|CH60_BIFA0 60 kDa chaperonin OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=groL PE=3 SV=1 17 142 2.0E-09
sp|Q8GJ00|CH60_FUSNP 60 kDa chaperonin OS=Fusobacterium nucleatum subsp. polymorphum GN=groL PE=3 SV=1 20 142 2.0E-09
sp|O34198|CH60_RICRI 60 kDa chaperonin (Fragment) OS=Rickettsia rickettsii GN=groL PE=3 SV=1 19 142 2.0E-09
sp|Q8NM64|CH602_CORGL 60 kDa chaperonin 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=groL2 PE=3 SV=1 20 142 2.0E-09
sp|Q493W7|CH60_BLOPB 60 kDa chaperonin OS=Blochmannia pennsylvanicus (strain BPEN) GN=groL PE=3 SV=1 19 238 2.0E-09
sp|Q7U348|CH60_BLOFL 60 kDa chaperonin OS=Blochmannia floridanus GN=groL PE=3 SV=1 19 238 2.0E-09
sp|A1R074|CH60_BORT9 60 kDa chaperonin OS=Borrelia turicatae (strain 91E135) GN=groL PE=3 SV=1 20 245 2.0E-09
sp|A9GB11|CH601_SORC5 60 kDa chaperonin 1 OS=Sorangium cellulosum (strain So ce56) GN=groL1 PE=3 SV=1 22 142 2.0E-09
sp|A3CKI1|CH60_STRSV 60 kDa chaperonin OS=Streptococcus sanguinis (strain SK36) GN=groL PE=3 SV=1 21 220 2.0E-09
sp|Q8KJ16|CH60_STRSA 60 kDa chaperonin OS=Streptococcus sanguinis GN=groL PE=3 SV=1 21 220 2.0E-09
sp|Q19NJ4|CH602_ECOK1 60 kDa chaperonin 2 OS=Escherichia coli O1:K1 / APEC GN=groL2 PE=3 SV=1 19 140 2.0E-09
sp|Q8KIX4|CH60_BUCPP 60 kDa chaperonin OS=Buchnera aphidicola subsp. Pterocomma populeum GN=groL PE=3 SV=1 19 238 2.0E-09
sp|Q8KM30|CH60_OLEAN 60 kDa chaperonin OS=Oleispira antarctica GN=groL PE=3 SV=1 19 142 2.0E-09
sp|P63039|CH60_RAT 60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus GN=Hspd1 PE=1 SV=1 19 528 2.0E-09
sp|P63038|CH60_MOUSE 60 kDa heat shock protein, mitochondrial OS=Mus musculus GN=Hspd1 PE=1 SV=1 19 528 2.0E-09
sp|A8GPB6|CH60_RICAH 60 kDa chaperonin OS=Rickettsia akari (strain Hartford) GN=groL PE=3 SV=1 19 142 2.0E-09
sp|Q6ADK2|CH60_LEIXX 60 kDa chaperonin OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=groL PE=3 SV=1 20 245 2.0E-09
sp|P21238|CPNA1_ARATH Chaperonin 60 subunit alpha 1, chloroplastic OS=Arabidopsis thaliana GN=CPN60A1 PE=1 SV=2 20 238 2.0E-09
sp|Q929V0|CH60_LISIN 60 kDa chaperonin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=groL PE=3 SV=1 20 139 2.0E-09
sp|A6TLJ1|CH60_ALKMQ 60 kDa chaperonin OS=Alkaliphilus metalliredigens (strain QYMF) GN=groL PE=3 SV=1 19 151 2.0E-09
sp|Q9XCA9|CH60_RHOMR 60 kDa chaperonin OS=Rhodothermus marinus GN=groL PE=3 SV=1 21 526 2.0E-09
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 20 139 2.0E-09
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 20 139 2.0E-09
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 20 139 2.0E-09
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 20 139 2.0E-09
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 20 139 2.0E-09
sp|P35470|CH602_RHIME 60 kDa chaperonin 2 OS=Rhizobium meliloti (strain 1021) GN=groL2 PE=2 SV=2 21 149 2.0E-09
sp|Q4JXN8|CH601_CORJK 60 kDa chaperonin 1 OS=Corynebacterium jeikeium (strain K411) GN=groL1 PE=3 SV=1 20 147 2.0E-09
sp|A8M497|CH602_SALAI 60 kDa chaperonin 2 OS=Salinispora arenicola (strain CNS-205) GN=groL2 PE=3 SV=1 29 236 2.0E-09
sp|Q2NBL8|CH601_ERYLH 60 kDa chaperonin 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL1 PE=3 SV=1 21 149 2.0E-09
sp|Q60024|CH60_THEBR 60 kDa chaperonin OS=Thermoanaerobacter brockii GN=groL PE=1 SV=2 19 139 2.0E-09
sp|Q6F8P6|CH60_ACIAD 60 kDa chaperonin OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=groL PE=3 SV=1 19 142 3.0E-09
sp|Q93QI2|CH60_RHOHA 60 kDa chaperonin OS=Rhodococcus hoagii GN=groL PE=3 SV=1 20 526 3.0E-09
sp|B1HT15|CH60_LYSSC 60 kDa chaperonin OS=Lysinibacillus sphaericus (strain C3-41) GN=groL PE=3 SV=1 20 139 3.0E-09
sp|A6U901|CH603_SINMW 60 kDa chaperonin 3 OS=Sinorhizobium medicae (strain WSM419) GN=groL3 PE=3 SV=1 21 236 3.0E-09
sp|Q92H04|CH60_RICCN 60 kDa chaperonin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=groL PE=3 SV=1 19 142 3.0E-09
sp|C3PP72|CH60_RICAE 60 kDa chaperonin OS=Rickettsia africae (strain ESF-5) GN=groL PE=3 SV=1 19 142 3.0E-09
sp|A8GT30|CH60_RICRS 60 kDa chaperonin OS=Rickettsia rickettsii (strain Sheila Smith) GN=groL PE=3 SV=1 19 142 3.0E-09
sp|B0BUM0|CH60_RICRO 60 kDa chaperonin OS=Rickettsia rickettsii (strain Iowa) GN=groL PE=3 SV=1 19 142 3.0E-09
sp|C4K2T9|CH60_RICPU 60 kDa chaperonin OS=Rickettsia peacockii (strain Rustic) GN=groL PE=3 SV=1 19 142 3.0E-09
sp|Q5Z1F9|CH601_NOCFA 60 kDa chaperonin 1 OS=Nocardia farcinica (strain IFM 10152) GN=groL1 PE=3 SV=1 20 236 3.0E-09
sp|A0QSS4|CH602_MYCS2 60 kDa chaperonin 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=groL2 PE=1 SV=1 17 236 3.0E-09
sp|Q9REU4|CH60_BIFAA 60 kDa chaperonin OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=groL PE=3 SV=3 20 144 3.0E-09
sp|A6Q2B4|CH60_NITSB 60 kDa chaperonin OS=Nitratiruptor sp. (strain SB155-2) GN=groL PE=3 SV=1 22 514 3.0E-09
sp|Q0RBS5|CH603_FRAAA 60 kDa chaperonin 3 OS=Frankia alni (strain ACN14a) GN=groL3 PE=3 SV=2 20 528 3.0E-09
sp|Q03MK3|CH60_STRTD 60 kDa chaperonin OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=groL PE=3 SV=1 21 220 3.0E-09
sp|Q5M670|CH60_STRT2 60 kDa chaperonin OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=groL PE=3 SV=1 21 220 3.0E-09
sp|Q5M1M9|CH60_STRT1 60 kDa chaperonin OS=Streptococcus thermophilus (strain CNRZ 1066) GN=groL PE=3 SV=1 21 220 3.0E-09
sp|B9E899|CH60_MACCJ 60 kDa chaperonin OS=Macrococcus caseolyticus (strain JCSC5402) GN=groL PE=3 SV=1 20 138 3.0E-09
sp|Q49YY5|CH60_STAS1 60 kDa chaperonin OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=groL PE=3 SV=1 20 140 3.0E-09
sp|Q1GJ36|CH60_RUEST 60 kDa chaperonin OS=Ruegeria sp. (strain TM1040) GN=groL PE=3 SV=1 21 142 3.0E-09
sp|Q4K764|CH60_PSEF5 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=groL PE=3 SV=1 19 139 3.0E-09
sp|B2UKV8|CH60_AKKM8 60 kDa chaperonin OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=groL PE=3 SV=1 20 150 3.0E-09
sp|Q46XW6|CH60_CUPPJ 60 kDa chaperonin OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=groL PE=3 SV=1 19 526 4.0E-09
sp|P47632|CH60_MYCGE 60 kDa chaperonin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=groL PE=3 SV=1 19 140 4.0E-09
sp|A6VB57|CH60_PSEA7 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain PA7) GN=groL PE=3 SV=1 19 142 4.0E-09
sp|P30718|CH60_PSEAE 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=groL PE=1 SV=3 19 142 4.0E-09
sp|Q02H55|CH60_PSEAB 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=groL PE=3 SV=1 19 142 4.0E-09
sp|B7UZG3|CH60_PSEA8 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain LESB58) GN=groL PE=3 SV=1 19 142 4.0E-09
sp|A5U892|CH602_MYCTA 60 kDa chaperonin 2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=groL2 PE=3 SV=1 17 236 4.0E-09
sp|A1KPA8|CH602_MYCBP 60 kDa chaperonin 2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=groL2 PE=3 SV=1 17 236 4.0E-09
sp|P9WPE9|CH601_MYCTU 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=groEL1 PE=1 SV=1 17 236 4.0E-09
sp|P9WPE8|CH601_MYCTO 60 kDa chaperonin 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=groEL1 PE=3 SV=1 17 236 4.0E-09
sp|P0A519|CH601_MYCBO 60 kDa chaperonin 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=groL1 PE=1 SV=1 17 236 4.0E-09
sp|Q2SDG0|CH60_HAHCH 60 kDa chaperonin OS=Hahella chejuensis (strain KCTC 2396) GN=groL PE=3 SV=1 19 139 4.0E-09
sp|B3PLM6|CH60_CELJU 60 kDa chaperonin OS=Cellvibrio japonicus (strain Ueda107) GN=groL PE=3 SV=1 19 143 4.0E-09
sp|A6LJ30|CH60_THEM4 60 kDa chaperonin OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=groL PE=3 SV=1 20 140 4.0E-09
sp|A0QQU5|CH601_MYCS2 60 kDa chaperonin 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=groL1 PE=1 SV=1 20 245 4.0E-09
sp|B0KFQ2|CH60_PSEPG 60 kDa chaperonin OS=Pseudomonas putida (strain GB-1) GN=groL PE=3 SV=1 19 237 4.0E-09
sp|A5N5D7|CH60_CLOK5 60 kDa chaperonin OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=groL PE=3 SV=1 20 140 4.0E-09
sp|B9DYY5|CH60_CLOK1 60 kDa chaperonin OS=Clostridium kluyveri (strain NBRC 12016) GN=groL PE=3 SV=1 20 140 4.0E-09
sp|Q1BCW7|CH602_MYCSS 60 kDa chaperonin 2 OS=Mycobacterium sp. (strain MCS) GN=groL2 PE=3 SV=1 17 142 4.0E-09
sp|A1UC26|CH602_MYCSK 60 kDa chaperonin 2 OS=Mycobacterium sp. (strain KMS) GN=groL2 PE=3 SV=1 17 142 4.0E-09
sp|A3PVQ7|CH602_MYCSJ 60 kDa chaperonin 2 OS=Mycobacterium sp. (strain JLS) GN=groL2 PE=3 SV=1 17 142 4.0E-09
sp|A4XYM0|CH60_PSEMY 60 kDa chaperonin OS=Pseudomonas mendocina (strain ymp) GN=groL PE=3 SV=1 19 142 4.0E-09
sp|A1RNN6|CH60_SHESW 60 kDa chaperonin OS=Shewanella sp. (strain W3-18-1) GN=groL PE=3 SV=1 19 144 4.0E-09
sp|C3K1A0|CH60_PSEFS 60 kDa chaperonin OS=Pseudomonas fluorescens (strain SBW25) GN=groL PE=3 SV=1 19 144 4.0E-09
sp|Q4UMF2|CH60_RICFE 60 kDa chaperonin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=groL PE=3 SV=1 19 142 4.0E-09
sp|A4Y398|CH60_SHEPC 60 kDa chaperonin OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=groL PE=3 SV=1 19 144 4.0E-09
sp|P48216|CH60_PSEPU 60 kDa chaperonin OS=Pseudomonas putida GN=groL PE=1 SV=3 19 161 5.0E-09
sp|Q93GW2|CH60_CAMRE 60 kDa chaperonin OS=Campylobacter rectus GN=groL PE=3 SV=1 20 514 5.0E-09
sp|Q43298|CH62_MAIZE Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=CPN60II PE=2 SV=1 19 526 5.0E-09
sp|P78012|CH60_MYCPN 60 kDa chaperonin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=groL PE=1 SV=1 19 138 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6815
MASFQPTQIFEEGTTQEKGENARLAAFVGAIAVGDLVKSTLGPKGMDKILQSASTGDIMVTNDGATILKSIALDN
AAAKVLVNISKVQDDEVGDGTTSVAVLAAELLREAERLVDKKIHPQTIIEGYRIASQAALKALQESAVDHSKNAA
AFRSDLQAIARTTLSSKVLAQDRDHFAALACDAVLRLKTSSDLSHIQIIKKAGGKLNDSYLDEGFILDKKIGVNQ
PKRLEKAKILIANTSMDTDKVKIFGARVKVGSTSKLAELEKAEKEKMKAKVEKIKSHGINCFINRQLIYNWPEQL
FTDAGIMSIEHADFDGIERLALVTGGEITSTFDHPEQVKLGGCDVIEEVIIGEDTLIKFSGVSAGEACTIVLRGA
TEQLLDEAERSLHDALAVLSQTVIEPRTTLGGGCAEMVMAKAVEGAATRIEGKKQAAVSSFAVALRQLPTILADN
AGLDSGDLVARLRKAIYDGLTTYGLDLTTPGGGLADMRDVGVIESYKLKRAVVSSASEAAELLLRVDDIIRAAPR
KRERM*
Coding >OphauB2|6815
ATGGCGTCGTTTCAGCCAACTCAAATTTTCGAAGAGGGCACAACTCAGGAAAAGGGCGAGAATGCGCGACTCGCC
GCCTTTGTCGGAGCCATTGCTGTCGGCGACTTGGTCAAAAGTACCCTGGGCCCAAAGGGAATGGACAAGATTCTC
CAGTCAGCATCCACGGGCGACATCATGGTGACAAACGACGGGGCTACGATACTCAAGTCGATTGCGCTTGATAAT
GCGGCTGCCAAAGTCTTGGTCAACATATCCAAGGTGCAGGACGACGAAGTCGGCGATGGCACAACTTCGGTTGCG
GTGCTGGCGGCCGAGCTGCTGAGAGAAGCGGAAAGACTAGTCGACAAGAAGATACATCCACAAACCATCATTGAG
GGATACAGGATAGCAAGCCAAGCCGCGCTCAAGGCTTTGCAAGAGTCGGCTGTAGACCACAGCAAGAATGCTGCA
GCATTCCGCTCAGACTTGCAGGCCATTGCGCGAACAACACTGAGCTCCAAGGTTCTGGCTCAGGATCGAGACCAT
TTCGCAGCACTGGCCTGCGATGCTGTGTTGCGGTTGAAGACGTCTTCGGATCTCAGCCACATTCAAATCATCAAA
AAGGCTGGCGGAAAGCTCAACGACTCGTACCTCGATGAGGGGTTTATTCTTGACAAGAAGATTGGCGTAAACCAG
CCGAAAAGGCTGGAAAAGGCAAAGATTTTGATCGCAAACACGTCCATGGACACGGACAAGGTGAAGATTTTCGGA
GCTCGCGTCAAGGTTGGGTCGACGAGCAAGTTGGCAGAACTGGAAAAGGCAGAAAAGGAAAAGATGAAGGCCAAG
GTTGAGAAAATCAAGTCACATGGCATCAACTGCTTTATCAATCGACAGCTCATCTATAATTGGCCAGAGCAGTTG
TTTACCGATGCTGGCATCATGTCCATTGAGCACGCCGATTTTGATGGCATTGAACGATTGGCTCTGGTGACAGGG
GGCGAAATTACGTCGACATTTGACCATCCTGAACAGGTTAAACTCGGAGGCTGCGATGTTATTGAAGAAGTCATT
ATTGGCGAGGACACACTCATCAAGTTTTCGGGTGTGTCTGCGGGCGAAGCATGCACAATTGTTTTGCGGGGAGCA
ACGGAGCAGCTGCTGGACGAGGCAGAGCGCAGCCTACATGACGCATTAGCCGTACTGTCTCAAACCGTCATCGAG
CCCAGGACTACGTTGGGCGGCGGTTGTGCCGAGATGGTCATGGCCAAGGCAGTCGAGGGCGCGGCAACGCGCATC
GAAGGCAAGAAGCAGGCAGCGGTGTCGAGCTTCGCCGTGGCTTTGCGGCAACTGCCAACCATTCTGGCTGATAAC
GCTGGTCTAGATTCTGGAGATCTTGTGGCACGTCTTCGCAAGGCGATTTACGATGGCTTGACGACTTATGGCCTA
GACTTGACAACGCCAGGTGGGGGCTTGGCTGATATGCGGGATGTAGGCGTGATTGAGAGCTACAAACTAAAGAGA
GCCGTGGTGTCGTCGGCCAGCGAGGCAGCAGAGTTGCTTCTTCGGGTGGACGACATAATCAGAGCAGCGCCACGG
AAGCGCGAGCGCATGTAG
Transcript >OphauB2|6815
ATGGCGTCGTTTCAGCCAACTCAAATTTTCGAAGAGGGCACAACTCAGGAAAAGGGCGAGAATGCGCGACTCGCC
GCCTTTGTCGGAGCCATTGCTGTCGGCGACTTGGTCAAAAGTACCCTGGGCCCAAAGGGAATGGACAAGATTCTC
CAGTCAGCATCCACGGGCGACATCATGGTGACAAACGACGGGGCTACGATACTCAAGTCGATTGCGCTTGATAAT
GCGGCTGCCAAAGTCTTGGTCAACATATCCAAGGTGCAGGACGACGAAGTCGGCGATGGCACAACTTCGGTTGCG
GTGCTGGCGGCCGAGCTGCTGAGAGAAGCGGAAAGACTAGTCGACAAGAAGATACATCCACAAACCATCATTGAG
GGATACAGGATAGCAAGCCAAGCCGCGCTCAAGGCTTTGCAAGAGTCGGCTGTAGACCACAGCAAGAATGCTGCA
GCATTCCGCTCAGACTTGCAGGCCATTGCGCGAACAACACTGAGCTCCAAGGTTCTGGCTCAGGATCGAGACCAT
TTCGCAGCACTGGCCTGCGATGCTGTGTTGCGGTTGAAGACGTCTTCGGATCTCAGCCACATTCAAATCATCAAA
AAGGCTGGCGGAAAGCTCAACGACTCGTACCTCGATGAGGGGTTTATTCTTGACAAGAAGATTGGCGTAAACCAG
CCGAAAAGGCTGGAAAAGGCAAAGATTTTGATCGCAAACACGTCCATGGACACGGACAAGGTGAAGATTTTCGGA
GCTCGCGTCAAGGTTGGGTCGACGAGCAAGTTGGCAGAACTGGAAAAGGCAGAAAAGGAAAAGATGAAGGCCAAG
GTTGAGAAAATCAAGTCACATGGCATCAACTGCTTTATCAATCGACAGCTCATCTATAATTGGCCAGAGCAGTTG
TTTACCGATGCTGGCATCATGTCCATTGAGCACGCCGATTTTGATGGCATTGAACGATTGGCTCTGGTGACAGGG
GGCGAAATTACGTCGACATTTGACCATCCTGAACAGGTTAAACTCGGAGGCTGCGATGTTATTGAAGAAGTCATT
ATTGGCGAGGACACACTCATCAAGTTTTCGGGTGTGTCTGCGGGCGAAGCATGCACAATTGTTTTGCGGGGAGCA
ACGGAGCAGCTGCTGGACGAGGCAGAGCGCAGCCTACATGACGCATTAGCCGTACTGTCTCAAACCGTCATCGAG
CCCAGGACTACGTTGGGCGGCGGTTGTGCCGAGATGGTCATGGCCAAGGCAGTCGAGGGCGCGGCAACGCGCATC
GAAGGCAAGAAGCAGGCAGCGGTGTCGAGCTTCGCCGTGGCTTTGCGGCAACTGCCAACCATTCTGGCTGATAAC
GCTGGTCTAGATTCTGGAGATCTTGTGGCACGTCTTCGCAAGGCGATTTACGATGGCTTGACGACTTATGGCCTA
GACTTGACAACGCCAGGTGGGGGCTTGGCTGATATGCGGGATGTAGGCGTGATTGAGAGCTACAAACTAAAGAGA
GCCGTGGTGTCGTCGGCCAGCGAGGCAGCAGAGTTGCTTCTTCGGGTGGACGACATAATCAGAGCAGCGCCACGG
AAGCGCGAGCGCATGTAG
Gene >OphauB2|6815
ATGGTAGGCCGTCTTTGCAGAATACCTCTTGATTGTCCAAGGGTCGCAGTTAACCTAGTATGCTCATGGTCTAGG
CGTCGTTTCAGCCAACTCAAATTTTCGAAGAGGGCACAACTCAGGAAAAGGGCGAGAATGCGCGACTCGCCGCCT
TTGTCGGAGCCATTGCTGTCGGCGACTTGGTCAAAAGTACCCTGGGCCCAAAGGGAATGGACAAGATTCTCCAGT
CAGCGTAAGTTGTCTCGTGGCGTTTTTCCGCCCTAGCTACAAATGCTGAGGTTGCGACAATCAGATCCACGGGCG
ACATCATGGTGACAAACGACGGGGCTACGATACTCAAGTCGATTGCGCTTGATAATGCGGCTGCCAAAGTCTTGG
TCAACATATCCAAGGTGCAGGACGACGAAGTCGGCGATGGCACAACTTCGGTTGCGGTGCTGGCGGCCGAGCTGC
TGAGAGAAGCGGAAAGACTAGTCGACAAGAAGATACATCCACAAACCATCATTGAGGGATACAGGATAGCAAGCC
AAGCCGCGCTCAAGGCTTTGCAAGAGTCGGCTGTAGACCACAGCAAGAATGCTGCAGCATTCCGCTCAGACTTGC
AGGCCATTGCGCGAACAACACTGAGCTCCAAGGTTCTGGCTCAGGATCGAGACCATTTCGCAGCACTGGCCTGCG
ATGCTGTGTTGCGGTTGAAGACGTCTTCGGATCTCAGCCACATTCAAATCATCAAAAAGGCTGGCGGAAAGCTCA
ACGACTCGTACCTCGATGAGGGGTTTATTCTTGACAAGAAGATTGGCGTAAACCAGCCGAAAAGGCTGGAAAAGG
CAAAGATTTTGATCGCAAACACGTCCATGGACACGGACAAGGTGAAGATTTTCGGAGCTCGCGTCAAGGTTGGGT
CGACGAGCAAGTTGGCAGAACTGGAAAAGGCAGAAAAGGAAAAGATGAAGGCCAAGGTTGAGAAAATCAAGTCAC
ATGGCATCAACTGCTTTATCAATCGACAGCTCATCTATAATTGGCCAGAGCAGTTGTTTACCGATGCTGGCATCA
TGTCCATTGAGCACGCCGATTTTGATGGCATTGAACGATTGGCTCTGGTGACAGGGGGCGAAATTACGTCGACAT
TTGACCATCCTGAACAGGTTAAACTCGGAGGCTGCGATGTTATTGAAGAAGTCATTATTGGCGAGGACACACTCA
TCAAGTTTTCGGGTGTGTCTGCGGGCGAAGCATGCACAATTGTTTTGCGGGGAGCAACGGAGCAGCTGCTGGACG
AGGCAGAGCGCAGCCTACATGACGCATTAGCCGTACTGTCTCAAACCGTCATCGAGCCCAGGACTACGTTGGGCG
GCGGTTGTGCCGAGATGGTCATGGCCAAGGCAGTCGAGGGCGCGGCAACGCGCATCGAAGGCAAGAAGCAGGCAG
CGGTGTCGAGCTTCGCCGTGGCTTTGCGGCAACTGCCAACCATTCTGGCTGATAACGCTGGTCTAGATTCTGGAG
ATCTTGTGGCACGTCTTCGCAAGGCGATTTACGATGGCTTGACGACTTATGGCCTAGACTTGACAACGCCAGGTG
GGGGCTTGGCTGATATGCGGGATGTAGGCGTGATTGAGAGCTACAAACTAAAGAGAGCCGTGGTGTCGTCGGCCA
GCGAGGCAGCAGAGGTGAGAACAAGGCGGCGTTTGCTTGATGCAGTGGCTCAATGAGTGGGTGCTAACATGACGG
GTCCAGTTGCTTCTTCGGGTGGACGACATAATCAGAGCAGCGCCACGGAAGCGCGAGCGCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail