Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6804
Gene name
LocationContig_66:30274..31749
Strand+
Gene length (bp)1475
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 3.1E-05 62 105
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 3.7E-02 126 166
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 3.8E-08 181 223
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 1.6E-04 294 319
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 5.7E-03 332 368

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O80642|PGTB1_ARATH Geranylgeranyl transferase type-1 subunit beta OS=Arabidopsis thaliana GN=GGB PE=1 SV=1 7 375 4.0E-35
sp|P53609|PGTB1_HUMAN Geranylgeranyl transferase type-1 subunit beta OS=Homo sapiens GN=PGGT1B PE=1 SV=2 7 369 2.0E-33
sp|Q5EAD5|PGTB1_BOVIN Geranylgeranyl transferase type-1 subunit beta OS=Bos taurus GN=PGGT1B PE=2 SV=1 7 369 2.0E-33
sp|P53610|PGTB1_RAT Geranylgeranyl transferase type-1 subunit beta OS=Rattus norvegicus GN=Pggt1b PE=1 SV=1 7 369 3.0E-33
sp|Q8BUY9|PGTB1_MOUSE Geranylgeranyl transferase type-1 subunit beta OS=Mus musculus GN=Pggt1b PE=1 SV=1 7 369 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O80642|PGTB1_ARATH Geranylgeranyl transferase type-1 subunit beta OS=Arabidopsis thaliana GN=GGB PE=1 SV=1 7 375 4.0E-35
sp|P53609|PGTB1_HUMAN Geranylgeranyl transferase type-1 subunit beta OS=Homo sapiens GN=PGGT1B PE=1 SV=2 7 369 2.0E-33
sp|Q5EAD5|PGTB1_BOVIN Geranylgeranyl transferase type-1 subunit beta OS=Bos taurus GN=PGGT1B PE=2 SV=1 7 369 2.0E-33
sp|P53610|PGTB1_RAT Geranylgeranyl transferase type-1 subunit beta OS=Rattus norvegicus GN=Pggt1b PE=1 SV=1 7 369 3.0E-33
sp|Q8BUY9|PGTB1_MOUSE Geranylgeranyl transferase type-1 subunit beta OS=Mus musculus GN=Pggt1b PE=1 SV=1 7 369 4.0E-33
sp|P32434|PGTB1_SCHPO Geranylgeranyl transferase type-1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwg2 PE=3 SV=1 9 399 9.0E-26
sp|Q5E9B3|PGTB2_BOVIN Geranylgeranyl transferase type-2 subunit beta OS=Bos taurus GN=RABGGTB PE=2 SV=1 28 394 1.0E-24
sp|O13782|FNTB_SCHPO Protein farnesyltransferase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cpp1 PE=1 SV=1 7 365 2.0E-24
sp|P53611|PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens GN=RABGGTB PE=1 SV=2 28 394 4.0E-24
sp|P53612|PGTB2_MOUSE Geranylgeranyl transferase type-2 subunit beta OS=Mus musculus GN=Rabggtb PE=1 SV=2 28 394 1.0E-23
sp|Q08603|PGTB2_RAT Geranylgeranyl transferase type-2 subunit beta OS=Rattus norvegicus GN=Rabggtb PE=1 SV=1 28 394 3.0E-23
sp|B0G172|PGTB2_DICDI Probable geranylgeranyl transferase type-2 subunit beta OS=Dictyostelium discoideum GN=rabggtb PE=3 SV=1 57 367 4.0E-20
sp|P18898|PGTB1_YEAST Geranylgeranyl transferase type-1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC43 PE=1 SV=2 11 385 2.0E-19
sp|P20133|PGTB2_YEAST Geranylgeranyl transferase type-2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET2 PE=1 SV=3 9 389 2.0E-19
sp|O93830|PGTB2_CANAX Geranylgeranyl transferase type-2 subunit beta OS=Candida albicans GN=BET2 PE=3 SV=1 6 390 9.0E-19
sp|P49355|FNTB_BOVIN Protein farnesyltransferase subunit beta OS=Bos taurus GN=FNTB PE=2 SV=1 6 366 2.0E-15
sp|Q02293|FNTB_RAT Protein farnesyltransferase subunit beta OS=Rattus norvegicus GN=Fntb PE=1 SV=1 6 366 5.0E-15
sp|Q8K2I1|FNTB_MOUSE Protein farnesyltransferase subunit beta OS=Mus musculus GN=Fntb PE=1 SV=1 6 366 6.0E-15
sp|P49356|FNTB_HUMAN Protein farnesyltransferase subunit beta OS=Homo sapiens GN=FNTB PE=1 SV=1 6 366 8.0E-15
sp|P41992|GGTB2_CAEEL Probable geranylgeranyl transferase type-2 subunit beta OS=Caenorhabditis elegans GN=ggtb-1 PE=3 SV=2 127 380 2.0E-12
sp|P46960|PGTB2_SCHPO Geranylgeranyl transferase type-2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptb1 PE=3 SV=1 6 391 2.0E-12
sp|Q04903|FNTB_PEA Protein farnesyltransferase subunit beta OS=Pisum sativum GN=FTB PE=1 SV=1 35 324 3.0E-11
sp|Q55DA3|PGTB1_DICDI Geranylgeranyl transferase type-1 subunit beta OS=Dictyostelium discoideum GN=pggt1b PE=2 SV=1 294 366 1.0E-10
sp|Q55D51|FNTB_DICDI Protein farnesyltransferase subunit beta OS=Dictyostelium discoideum GN=fntB PE=3 SV=1 117 372 3.0E-10
sp|P22007|FNTB_YEAST Protein farnesyltransferase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAM1 PE=1 SV=2 4 366 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6804
MAYEPVFEKAKHIQYWQRCHNTYLPTAYTSNDSTRVTFAYFIISALDLLHVPLSAQDRFATRRWVLSLQHPDGGF
CGSPAHVPSGEQRGKMDGSANLAATYFSLLLLGAAAATDDEARAAFACVRRKRLLRWLRTLQRGDGSFGQLVWEG
EAMGGHDVRHSYLASCVRWMLRDSADEQDLNVDKMVAYIRQGQTYDGGLADASEHESHAGYAYCAAAALYMLDRP
LGSAACDERGNALTKGIAHDKDLISFLIHRPFDYQAKNEAADEMGENYIETKLSQLSLCEGSRHPSYIGYNGRWN
KKADTCYCWWVAGTLKILGSLDLIDAAPSRKYILDITQHRIGGFAKAVGRPPDIYHSYLGLAALALLDQKELKPF
DVGLCCSMEMARKIALAREGFEGAGKMSFDEDGFWHVAAQA*
Coding >OphauB2|6804
ATGGCATATGAGCCCGTCTTTGAAAAGGCCAAACACATTCAATACTGGCAGCGCTGCCACAACACATACCTCCCT
ACCGCCTACACCTCCAACGACTCAACCCGCGTCACTTTTGCATACTTTATCATCTCCGCTCTAGATCTCCTCCAC
GTCCCCCTCTCAGCGCAAGATCGCTTCGCCACTCGACGCTGGGTGCTTAGTCTACAGCATCCAGACGGGGGCTTC
TGCGGCAGTCCGGCGCACGTTCCGTCAGGGGAGCAGCGTGGCAAGATGGATGGAAGCGCGAATCTTGCCGCTACA
TATTTCTCGCTGCTGCTGCTTGGTGCTGCGGCCGCCACTGATGACGAGGCGCGTGCCGCGTTTGCATGCGTCCGG
AGAAAAAGACTACTCAGGTGGTTACGCACGCTGCAGCGTGGCGATGGCAGTTTTGGGCAGCTGGTGTGGGAGGGA
GAAGCCATGGGTGGACATGACGTCCGGCATAGCTACCTCGCGAGCTGTGTGCGATGGATGCTGAGGGATTCAGCT
GATGAGCAAGATTTAAATGTCGACAAGATGGTGGCATATATCCGACAGGGGCAGACATACGATGGAGGCCTTGCA
GACGCTTCAGAGCATGAGTCGCATGCTGGGTATGCATATTGCGCTGCCGCGGCCCTGTATATGCTTGATCGGCCG
TTGGGGTCAGCAGCGTGTGATGAGCGAGGGAATGCATTGACAAAGGGCATAGCGCATGATAAGGACTTAATCAGC
TTCCTCATCCATCGCCCTTTTGACTATCAGGCTAAAAATGAAGCGGCTGATGAGATGGGAGAAAACTACATCGAG
ACAAAGTTGAGCCAGCTCAGCTTGTGTGAAGGATCCAGACACCCTTCGTATATCGGGTATAACGGCAGATGGAAT
AAGAAGGCAGATACGTGCTACTGCTGGTGGGTGGCTGGAACGCTCAAGATACTCGGGAGTCTGGATTTGATTGAT
GCCGCTCCGTCACGCAAGTATATTCTCGACATTACGCAGCACCGCATCGGCGGCTTTGCAAAGGCCGTGGGCCGG
CCGCCAGACATTTACCATTCGTACTTGGGACTAGCAGCCCTGGCGCTGCTTGATCAGAAGGAGCTCAAGCCGTTT
GATGTTGGCTTGTGCTGTAGCATGGAAATGGCGCGCAAGATTGCGTTAGCAAGAGAGGGGTTTGAGGGGGCGGGA
AAAATGAGCTTTGATGAGGATGGTTTTTGGCATGTTGCTGCACAGGCCTAA
Transcript >OphauB2|6804
ATGGCATATGAGCCCGTCTTTGAAAAGGCCAAACACATTCAATACTGGCAGCGCTGCCACAACACATACCTCCCT
ACCGCCTACACCTCCAACGACTCAACCCGCGTCACTTTTGCATACTTTATCATCTCCGCTCTAGATCTCCTCCAC
GTCCCCCTCTCAGCGCAAGATCGCTTCGCCACTCGACGCTGGGTGCTTAGTCTACAGCATCCAGACGGGGGCTTC
TGCGGCAGTCCGGCGCACGTTCCGTCAGGGGAGCAGCGTGGCAAGATGGATGGAAGCGCGAATCTTGCCGCTACA
TATTTCTCGCTGCTGCTGCTTGGTGCTGCGGCCGCCACTGATGACGAGGCGCGTGCCGCGTTTGCATGCGTCCGG
AGAAAAAGACTACTCAGGTGGTTACGCACGCTGCAGCGTGGCGATGGCAGTTTTGGGCAGCTGGTGTGGGAGGGA
GAAGCCATGGGTGGACATGACGTCCGGCATAGCTACCTCGCGAGCTGTGTGCGATGGATGCTGAGGGATTCAGCT
GATGAGCAAGATTTAAATGTCGACAAGATGGTGGCATATATCCGACAGGGGCAGACATACGATGGAGGCCTTGCA
GACGCTTCAGAGCATGAGTCGCATGCTGGGTATGCATATTGCGCTGCCGCGGCCCTGTATATGCTTGATCGGCCG
TTGGGGTCAGCAGCGTGTGATGAGCGAGGGAATGCATTGACAAAGGGCATAGCGCATGATAAGGACTTAATCAGC
TTCCTCATCCATCGCCCTTTTGACTATCAGGCTAAAAATGAAGCGGCTGATGAGATGGGAGAAAACTACATCGAG
ACAAAGTTGAGCCAGCTCAGCTTGTGTGAAGGATCCAGACACCCTTCGTATATCGGGTATAACGGCAGATGGAAT
AAGAAGGCAGATACGTGCTACTGCTGGTGGGTGGCTGGAACGCTCAAGATACTCGGGAGTCTGGATTTGATTGAT
GCCGCTCCGTCACGCAAGTATATTCTCGACATTACGCAGCACCGCATCGGCGGCTTTGCAAAGGCCGTGGGCCGG
CCGCCAGACATTTACCATTCGTACTTGGGACTAGCAGCCCTGGCGCTGCTTGATCAGAAGGAGCTCAAGCCGTTT
GATGTTGGCTTGTGCTGTAGCATGGAAATGGCGCGCAAGATTGCGTTAGCAAGAGAGGGGTTTGAGGGGGCGGGA
AAAATGAGCTTTGATGAGGATGGTTTTTGGCATGTTGCTGCACAGGCCTAA
Gene >OphauB2|6804
ATGGCATATGAGCCCGTCTTTGAAAAGGCCAAACACATTCAATACTGGCAGCGCTGCCACAACACATACCTCCCT
ACCGCCTACACCTCCAACGACTCAACCCGCGTCACTTTTGCATACTTTATCATCTCCGCTCTAGATCTCCTCCAC
GTCCCCCTCTCAGCGCAAGATCGCTTCGCCACTCGACGCTGGGTGCTTAGTCTACAGCATCCAGACGGGGGCTTC
TGCGGCAGTCCGGCGCACGTTCCGTCAGGGGAGCAGCGTGGCAAGATGGATGGAAGCGCGAATCTTGCCGCTACA
TATTTCTCGCTGCTGCTGCTTGGTGCTGCGGCCGCCACTGATGACGAGGCGCGTGCCGCGTTTGCATGCGTCCGG
AGAAAAAGACTACTCAGGTGGTTACGCACGCTGCAGCGTGGCGATGGCAGTTTTGGGCAGCTGGTGTGGGAGGGA
GAAGCCATGGGTGGACATGACGTCCGGCATAGCTACCTCGCGAGCTGTGTGCGATGGATGCTGAGGGATTCAGCT
GATGAGCAAGATTTAAATGTCGACAAGATGGTGGCATATATCCGACAGGGGCAGGTAAGTTGTCATAGCCTTTGA
CATGCGCTTACATCTGATGCCAGACAGACATACGATGGAGGCCTTGCAGACGCTTCAGAGCATGAGTCGCATGGT
ATGTTGCTTGCTTCAAGTAGTCATGGAAATGGCTGACTTGGGCTAGCTGGGTATGCATATTGCGCTGCCGCGGCC
CTGTATATGCTTGATCGGCCGTTGGGGTCAGCAGCGTGTGATGAGCGAGGGAATGCATTGACAAAGGGCATAGCG
CATGATAAGGACTTAATCAGCTTCCTCATCCATCGCCCTTTTGACTATCAGGCTAAAAATGAAGCGGCTGATGAG
ATGGGAGAAAACTACATCGAGACAAAGTTGAGCCAGCTCAGCTTGTGTGAAGGATCCAGACACCCTTCGTATATC
GGGTATAACGGCAGATGGAATAAGAAGGCAGATACGTGCTACTGCTGGTGGGTGGCTGGAACGCTCAAGGTATTA
ACTCCTTAGCCCTCTCTACTGCCATGGGCCTCACTTTGATCCGACCACACCCATACAAGACATATCAACTCAAAC
ACGCCCATAAGCCCTGGGCGCGGAACAAGCAGCTAATGCAGAGGCAGATACTCGGGAGTCTGGATTTGATTGATG
CCGCTCCGTCACGCAAGTATATTCTCGACATTACGCAGCACCGCATCGGCGGCTTTGCAAAGGCCGTGGGCCGGC
CGCCAGACATTTACCATTCGTACTTGGGACTAGCAGCCCTGGCGCTGCTTGATCAGAAGGAGCTCAAGCCGTTTG
ATGTTGGCTTGTGCTGTAGCATGGAAATGGCGCGCAAGATTGCGTTAGCAAGAGAGGGGTTTGAGGGGGCGGGAA
AAATGAGCTTTGATGAGGATGGTTTTTGGCATGTTGCTGCACAGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail