Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6803
Gene name
LocationContig_66:29022..29670
Strand-
Gene length (bp)648
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10311 Ilm1 Increased loss of mitochondrial DNA protein 1 1.1E-61 4 164

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 57 79 22
3 86 108 22
4 135 154 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6803
MPLITSKTLLTSISLFHMTLAFFFLTSPSTVNDQILVYILGESMGIPIVRGFDSPSAPLALLAVVLALLGLSDLV
SLSMPEELGSLYHWGTQAPLRSFITMALVFYSYFQSVRVPRGPSSAHDASLHGGNLTNRVVFTFAFLEMITWFWI
WVTLREERHGIIERMRKQGPGVRGQ*
Coding >OphauB2|6803
ATGCCGCTCATCACGTCCAAAACTCTTCTCACCTCTATCTCTCTCTTCCACATGACGCTTGCCTTCTTCTTCCTC
ACGAGCCCTAGCACCGTCAACGACCAGATTCTCGTCTATATTCTCGGCGAAAGCATGGGCATTCCCATCGTCCGC
GGCTTCGATTCTCCCAGCGCGCCTCTTGCTCTTCTCGCCGTCGTTCTAGCCCTCCTTGGCCTCTCTGACCTGGTC
TCCCTGTCCATGCCCGAGGAGCTCGGTTCGCTCTATCACTGGGGCACTCAGGCTCCTCTTCGCTCCTTCATCACC
ATGGCTCTCGTCTTCTACTCGTATTTTCAGTCGGTTCGCGTTCCTCGCGGTCCTTCAAGCGCCCACGACGCCTCT
CTGCACGGCGGCAATCTTACAAACCGCGTCGTCTTTACCTTTGCCTTTCTCGAAATGATCACCTGGTTCTGGATC
TGGGTGACGTTGCGCGAAGAGCGGCACGGCATCATTGAGCGAATGCGCAAACAAGGCCCGGGCGTGCGTGGACAA
TGA
Transcript >OphauB2|6803
ATGCCGCTCATCACGTCCAAAACTCTTCTCACCTCTATCTCTCTCTTCCACATGACGCTTGCCTTCTTCTTCCTC
ACGAGCCCTAGCACCGTCAACGACCAGATTCTCGTCTATATTCTCGGCGAAAGCATGGGCATTCCCATCGTCCGC
GGCTTCGATTCTCCCAGCGCGCCTCTTGCTCTTCTCGCCGTCGTTCTAGCCCTCCTTGGCCTCTCTGACCTGGTC
TCCCTGTCCATGCCCGAGGAGCTCGGTTCGCTCTATCACTGGGGCACTCAGGCTCCTCTTCGCTCCTTCATCACC
ATGGCTCTCGTCTTCTACTCGTATTTTCAGTCGGTTCGCGTTCCTCGCGGTCCTTCAAGCGCCCACGACGCCTCT
CTGCACGGCGGCAATCTTACAAACCGCGTCGTCTTTACCTTTGCCTTTCTCGAAATGATCACCTGGTTCTGGATC
TGGGTGACGTTGCGCGAAGAGCGGCACGGCATCATTGAGCGAATGCGCAAACAAGGCCCGGGCGTGCGTGGACAA
TGA
Gene >OphauB2|6803
ATGCCGCTCATCACGTCCAAAACTCTTCTCACCTCTATCTCTCTCTTCCACATGACGCTTGCCTTCTTCTTCCTC
ACGAGCCCTAGCACCGTCAACGACCAGATTCTCGTCTATATTCTCGGCGAAAGCATGGGCATTGTAAGTCAAGCT
GCTTGCGTTGTGGTCGATTCCCAACACGTCCCAGTGAGGATGCTGCCACCAATAACAAGGACGCAGCGCAAAACA
TATTGCAAAGGCTAACTAGCGTGTGCTGTGCAGCCCATCGTCCGCGGCTTCGATTCTCCCAGCGCGCCTCTTGCT
CTTCTCGCCGTCGTTCTAGCCCTCCTTGGCCTCTCTGACCTGGTCTCCCTGTCCATGCCCGAGGAGCTCGGTTCG
CTCTATCACTGGGGCACTCAGGCTCCTCTTCGCTCCTTCATCACCATGGCTCTCGTCTTCTACTCGTATTTTCAG
TCGGTTCGCGTTCCTCGCGGTCCTTCAAGCGCCCACGACGCCTCTCTGCACGGCGGCAATCTTACAAACCGCGTC
GTCTTTACCTTTGCCTTTCTCGAAATGATCACCTGGTTCTGGATCTGGGTGACGTTGCGCGAAGAGCGGCACGGC
ATCATTGAGCGAATGCGCAAACAAGGCCCGGGCGTGCGTGGACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail