Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6801
Gene name
LocationContig_66:22651..25614
Strand+
Gene length (bp)2963
Transcript length (bp)2328
Coding sequence length (bp)2328
Protein length (aa) 776

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.5E-46 388 740
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 5.4E-20 387 587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59763|OCA2_SCHPO Serine/threonine-protein kinase oca2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca2 PE=1 SV=1 262 772 2.0E-132
sp|Q08732|HRK1_YEAST Serine/threonine-protein kinase HRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRK1 PE=1 SV=1 336 681 4.0E-99
sp|P22211|NPR1_YEAST Nitrogen permease reactivator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPR1 PE=1 SV=2 299 762 7.0E-88
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 380 613 9.0E-85
sp|Q12310|PRR2_YEAST Serine/threonine-protein kinase PRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR2 PE=1 SV=1 380 603 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59763|OCA2_SCHPO Serine/threonine-protein kinase oca2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca2 PE=1 SV=1 262 772 2.0E-132
sp|Q08732|HRK1_YEAST Serine/threonine-protein kinase HRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRK1 PE=1 SV=1 336 681 4.0E-99
sp|P22211|NPR1_YEAST Nitrogen permease reactivator protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPR1 PE=1 SV=2 299 762 7.0E-88
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 380 613 9.0E-85
sp|Q12310|PRR2_YEAST Serine/threonine-protein kinase PRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRR2 PE=1 SV=1 380 603 2.0E-79
sp|Q09792|PPK8_SCHPO Serine/threonine-protein kinase ppk8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk8 PE=3 SV=1 310 604 4.0E-61
sp|P25333|HAL4_YEAST Serine/threonine-protein kinase HAL4/SAT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAT4 PE=1 SV=1 338 595 9.0E-52
sp|O14019|HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hal4 PE=1 SV=1 343 619 2.0E-48
sp|O74526|KJ45_SCHPO Probable serine/threonine-protein kinase C70.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC70.05c PE=1 SV=1 380 602 8.0E-38
sp|A7TGR2|HAL5_VANPO Probable serine/threonine-protein kinase HAL5-like OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_2001p30 PE=3 SV=1 380 601 8.0E-36
sp|Q757X8|HAL5_ASHGO Probable serine/threonine-protein kinase HAL5-like OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AEL118C PE=3 SV=1 358 589 9.0E-35
sp|Q6FJ85|KKQ8_CANGA Probable serine/threonine-protein kinase KKQ8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KKQ8 PE=3 SV=1 384 589 1.0E-33
sp|Q6CXN5|HAL5_KLULA Probable serine/threonine-protein kinase HAL5-like OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0A06820g PE=3 SV=1 318 589 5.0E-33
sp|P36004|KKQ8_YEAST Probable serine/threonine-protein kinase KKQ8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KKQ8 PE=1 SV=2 384 601 6.0E-33
sp|A6ZZF6|KKQ8_YEAS7 Probable serine/threonine-protein kinase KKQ8 OS=Saccharomyces cerevisiae (strain YJM789) GN=KKQ8 PE=3 SV=2 384 601 2.0E-32
sp|A6ZQG7|HAL5_YEAS7 Serine/threonine-protein kinase HAL5 OS=Saccharomyces cerevisiae (strain YJM789) GN=HAL5 PE=3 SV=1 350 604 8.0E-31
sp|Q6FQH2|HAL5_CANGA Serine/threonine-protein kinase HAL5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAL5 PE=3 SV=1 363 598 9.0E-31
sp|P38970|HAL5_YEAST Serine/threonine-protein kinase HAL5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAL5 PE=1 SV=2 350 604 2.0E-30
sp|P36002|PTK1_YEAST Serine/threonine-protein kinase PTK1/STK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTK1 PE=1 SV=3 358 602 3.0E-24
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 361 588 1.0E-23
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 383 583 2.0E-22
sp|P47116|PTK2_YEAST Serine/threonine-protein kinase PTK2/STK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTK2 PE=1 SV=1 391 601 2.0E-22
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 383 583 3.0E-22
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 386 588 6.0E-22
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 383 589 6.0E-22
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 383 583 1.0E-21
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 372 591 1.0E-21
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 383 586 2.0E-21
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 383 586 2.0E-21
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 383 586 2.0E-21
sp|P31374|PSK1_YEAST Serine/threonine-protein kinase PSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK1 PE=1 SV=2 391 588 2.0E-21
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 381 601 2.0E-21
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 359 588 2.0E-21
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 359 588 2.0E-21
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 372 598 2.0E-21
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 384 583 2.0E-21
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 372 591 4.0E-21
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 380 588 5.0E-21
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 384 583 5.0E-21
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 383 588 5.0E-21
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 384 610 6.0E-21
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 375 591 6.0E-21
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 387 589 6.0E-21
sp|O94647|PPK24_SCHPO Serine/threonine-protein kinase ppk24, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk24 PE=1 SV=1 391 595 7.0E-21
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 375 591 7.0E-21
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 383 588 7.0E-21
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 375 591 1.0E-20
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 384 581 1.0E-20
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 373 588 1.0E-20
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 386 588 1.0E-20
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 372 591 1.0E-20
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 386 588 1.0E-20
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 391 610 2.0E-20
sp|Q6FRE7|PTK2_CANGA Serine/threonine-protein kinase PTK2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PTK2 PE=3 SV=1 384 602 2.0E-20
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 384 581 2.0E-20
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 359 588 2.0E-20
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 386 588 2.0E-20
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 386 588 2.0E-20
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 391 608 2.0E-20
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 391 608 3.0E-20
sp|Q9Y7W4|BUR1_CANAL Serine/threonine-protein kinase BUR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRK1 PE=3 SV=2 391 581 3.0E-20
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 383 589 3.0E-20
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 391 608 3.0E-20
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 386 588 3.0E-20
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 377 588 4.0E-20
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 391 608 4.0E-20
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 384 591 4.0E-20
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 391 608 4.0E-20
sp|P34208|CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chk1 PE=1 SV=2 387 615 4.0E-20
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 372 591 5.0E-20
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 386 588 5.0E-20
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 381 602 5.0E-20
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 391 582 5.0E-20
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 386 588 6.0E-20
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 373 601 8.0E-20
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 377 588 1.0E-19
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 388 603 1.0E-19
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 386 615 2.0E-19
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 386 588 2.0E-19
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 391 608 2.0E-19
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 386 588 2.0E-19
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 386 588 2.0E-19
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 386 588 2.0E-19
sp|Q96WV9|CDK9_SCHPO Probable cyclin-dependent kinase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdk9 PE=1 SV=1 387 606 2.0E-19
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 391 581 3.0E-19
sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. japonica GN=CDKG-2 PE=2 SV=2 391 607 3.0E-19
sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. indica GN=CDKG-2 PE=3 SV=1 391 607 3.0E-19
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 391 581 3.0E-19
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 388 607 3.0E-19
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 391 582 3.0E-19
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 380 611 3.0E-19
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 387 588 4.0E-19
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 391 591 4.0E-19
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 386 588 4.0E-19
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 386 588 4.0E-19
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 386 588 4.0E-19
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 391 618 4.0E-19
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 386 588 5.0E-19
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 383 606 5.0E-19
sp|Q6K5F8|CDKG1_ORYSJ Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1 391 608 5.0E-19
sp|Q9Z1B7|MK13_MOUSE Mitogen-activated protein kinase 13 OS=Mus musculus GN=Mapk13 PE=1 SV=2 391 581 6.0E-19
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 386 596 6.0E-19
sp|A2X6X1|CDKG1_ORYSI Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=3 SV=1 391 608 7.0E-19
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 387 588 7.0E-19
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 387 598 7.0E-19
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 391 581 7.0E-19
sp|Q1EBK0|SSN3_COCIM Serine/threonine-protein kinase SSN3 OS=Coccidioides immitis (strain RS) GN=SSN3 PE=3 SV=3 380 584 8.0E-19
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 387 599 9.0E-19
sp|Q9WTY9|MK13_RAT Mitogen-activated protein kinase 13 OS=Rattus norvegicus GN=Mapk13 PE=1 SV=1 391 581 9.0E-19
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 379 578 1.0E-18
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 379 578 1.0E-18
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 391 581 1.0E-18
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 383 607 1.0E-18
sp|O14328|KSP1_SCHPO Serine/threonine-protein kinase ksp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksp1 PE=1 SV=1 444 634 1.0E-18
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 391 581 1.0E-18
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 386 608 1.0E-18
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 375 588 1.0E-18
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 380 601 1.0E-18
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 348 581 1.0E-18
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 387 588 2.0E-18
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 381 581 2.0E-18
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 391 608 2.0E-18
sp|Q9N272|MK13_PANTR Mitogen-activated protein kinase 13 OS=Pan troglodytes GN=MAPK13 PE=2 SV=1 391 581 2.0E-18
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 386 591 2.0E-18
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 386 588 2.0E-18
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 384 607 2.0E-18
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 384 607 2.0E-18
sp|Q4P9T2|SSN3_USTMA Serine/threonine-protein kinase SSN3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SSN3 PE=3 SV=2 407 610 2.0E-18
sp|Q0TWJ7|SSN3_PHANO Serine/threonine-protein kinase SSN3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SSN3 PE=3 SV=1 411 584 3.0E-18
sp|O15264|MK13_HUMAN Mitogen-activated protein kinase 13 OS=Homo sapiens GN=MAPK13 PE=1 SV=1 391 581 3.0E-18
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 381 581 3.0E-18
sp|Q2GYV9|SSN3_CHAGB Serine/threonine-protein kinase SSN3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SSN3 PE=3 SV=1 380 584 3.0E-18
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 391 581 3.0E-18
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 391 591 3.0E-18
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 381 581 4.0E-18
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 386 603 4.0E-18
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 384 588 4.0E-18
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 386 588 4.0E-18
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 381 581 4.0E-18
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 376 601 4.0E-18
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 377 588 4.0E-18
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 384 588 4.0E-18
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 380 588 5.0E-18
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 386 596 5.0E-18
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 391 582 5.0E-18
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 382 581 6.0E-18
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 383 601 6.0E-18
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 386 588 6.0E-18
sp|Q3T0N5|MK13_BOVIN Mitogen-activated protein kinase 13 OS=Bos taurus GN=MAPK13 PE=2 SV=1 391 581 7.0E-18
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 383 584 7.0E-18
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 384 607 7.0E-18
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 384 607 8.0E-18
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 387 596 8.0E-18
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 388 593 8.0E-18
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 391 581 8.0E-18
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 383 588 8.0E-18
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 390 610 8.0E-18
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 391 582 8.0E-18
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 384 607 9.0E-18
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 375 582 9.0E-18
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 391 607 9.0E-18
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 383 584 9.0E-18
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 391 607 9.0E-18
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 391 583 1.0E-17
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 383 584 1.0E-17
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 375 582 1.0E-17
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 376 588 1.0E-17
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 375 582 1.0E-17
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 386 588 1.0E-17
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 377 588 1.0E-17
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 391 588 1.0E-17
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 391 594 1.0E-17
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 391 588 1.0E-17
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 377 588 2.0E-17
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 379 607 2.0E-17
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 383 607 2.0E-17
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 383 584 2.0E-17
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 380 588 2.0E-17
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 384 607 2.0E-17
sp|Q08217|PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK2 PE=1 SV=1 387 588 2.0E-17
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 383 607 2.0E-17
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 386 596 2.0E-17
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 376 588 2.0E-17
sp|Q5BAE1|SSN3_EMENI Serine/threonine-protein kinase ssn3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ssn3 PE=3 SV=2 383 671 2.0E-17
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 384 610 2.0E-17
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 386 598 2.0E-17
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 386 588 2.0E-17
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 343 588 2.0E-17
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 391 607 2.0E-17
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 381 607 2.0E-17
sp|Q54RB2|CDK11_DICDI Cyclin-dependent kinase 11 OS=Dictyostelium discoideum GN=cdk11 PE=3 SV=1 391 601 2.0E-17
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 391 581 3.0E-17
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 384 610 3.0E-17
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 384 610 3.0E-17
sp|A3LUB9|SSN3_PICST Serine/threonine-protein kinase SSN3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SSN3 PE=3 SV=2 373 584 3.0E-17
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 391 584 3.0E-17
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 391 581 3.0E-17
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 391 581 3.0E-17
sp|Q84TI6|CDKE1_ARATH Cyclin-dependent kinase E-1 OS=Arabidopsis thaliana GN=CDKE-1 PE=1 SV=2 383 600 3.0E-17
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 386 609 3.0E-17
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 381 581 3.0E-17
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 384 577 3.0E-17
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 381 604 4.0E-17
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 386 588 4.0E-17
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 423 619 4.0E-17
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 386 580 4.0E-17
sp|Q336M2|CDKE1_ORYSJ Cyclin-dependent kinase E-1 OS=Oryza sativa subsp. japonica GN=CDKE-1 PE=2 SV=2 383 600 4.0E-17
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 387 588 4.0E-17
sp|Q9UBE8|NLK_HUMAN Serine/threonine-protein kinase NLK OS=Homo sapiens GN=NLK PE=1 SV=2 389 589 4.0E-17
sp|D3ZSZ3|NLK_RAT Serine/threonine-protein kinase NLK OS=Rattus norvegicus GN=Nlk PE=3 SV=1 389 589 5.0E-17
sp|O54949|NLK_MOUSE Serine/threonine-protein kinase NLK OS=Mus musculus GN=Nlk PE=1 SV=2 389 589 5.0E-17
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 373 589 5.0E-17
sp|A2Y4B6|CDKD1_ORYSI Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. indica GN=CDKD-1 PE=2 SV=1 390 608 5.0E-17
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 383 611 5.0E-17
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 389 607 5.0E-17
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 391 583 5.0E-17
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 374 578 5.0E-17
sp|E2QWQ2|NLK_CANLF Serine/threonine-protein kinase NLK OS=Canis lupus familiaris GN=NLK PE=3 SV=1 389 589 5.0E-17
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 384 610 5.0E-17
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 306 578 5.0E-17
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 374 578 5.0E-17
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 391 591 6.0E-17
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 374 578 6.0E-17
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 386 577 6.0E-17
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 374 581 6.0E-17
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 374 581 6.0E-17
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 374 581 6.0E-17
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 391 583 6.0E-17
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 388 588 6.0E-17
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 374 578 6.0E-17
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 389 589 6.0E-17
sp|P29620|CDKD1_ORYSJ Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. japonica GN=CDKD-1 PE=1 SV=1 390 608 6.0E-17
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 391 596 7.0E-17
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 383 611 7.0E-17
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 391 581 7.0E-17
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 391 607 7.0E-17
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 374 578 7.0E-17
sp|E1BMN8|NLK_BOVIN Serine/threonine-protein kinase NLK OS=Bos taurus GN=NLK PE=3 SV=2 389 589 7.0E-17
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 389 673 7.0E-17
sp|Q96VK3|BUR1_EMENI Serine/threonine-protein kinase bur1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ptkA PE=2 SV=1 387 581 7.0E-17
sp|Q55GS4|CDK10_DICDI Probable cyclin-dependent kinase 10 OS=Dictyostelium discoideum GN=cdk10 PE=2 SV=1 391 660 7.0E-17
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 391 594 7.0E-17
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 383 611 8.0E-17
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 381 581 8.0E-17
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 374 578 1.0E-16
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 348 614 1.0E-16
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 348 614 1.0E-16
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 348 614 1.0E-16
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 384 588 1.0E-16
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 386 588 1.0E-16
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 386 588 1.0E-16
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 390 610 1.0E-16
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 391 591 1.0E-16
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 391 591 1.0E-16
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 381 589 1.0E-16
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 374 628 1.0E-16
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 391 596 1.0E-16
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 383 584 1.0E-16
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 386 578 1.0E-16
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 340 588 1.0E-16
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 380 588 1.0E-16
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 386 577 1.0E-16
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 391 588 1.0E-16
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 386 588 2.0E-16
sp|A4QXX4|SSN3_MAGO7 Serine/threonine-protein kinase SSN3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SSN3 PE=3 SV=2 380 599 2.0E-16
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 386 603 2.0E-16
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 389 596 2.0E-16
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 391 581 2.0E-16
sp|Q6C842|BUR1_YARLI Serine/threonine-protein kinase BUR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUR1 PE=3 SV=1 380 610 2.0E-16
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 383 587 2.0E-16
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 386 588 2.0E-16
sp|P0C198|CHK1_USTMA Serine/threonine-protein kinase CHK1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHK1 PE=3 SV=1 461 611 2.0E-16
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 388 588 2.0E-16
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 386 589 2.0E-16
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 384 577 2.0E-16
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 346 614 3.0E-16
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 346 614 3.0E-16
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 346 614 3.0E-16
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 389 604 3.0E-16
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 388 593 3.0E-16
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 386 588 3.0E-16
sp|Q6CCB0|SSN3_YARLI Serine/threonine-protein kinase SSN3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SSN3 PE=3 SV=1 380 584 3.0E-16
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 386 596 3.0E-16
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 389 608 3.0E-16
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 383 578 3.0E-16
sp|B1H3E1|NLK2_XENTR Serine/threonine-protein kinase NLK2 OS=Xenopus tropicalis GN=nlk.2 PE=2 SV=1 389 589 3.0E-16
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 340 589 3.0E-16
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 319 617 3.0E-16
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 391 581 3.0E-16
sp|Q2UC58|SSN3_ASPOR Serine/threonine-protein kinase SSN3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ssn3 PE=3 SV=2 383 671 3.0E-16
sp|Q8QGV6|NLK2_XENLA Serine/threonine-protein kinase NLK2 OS=Xenopus laevis GN=nlk.2 PE=1 SV=1 389 589 3.0E-16
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 346 614 4.0E-16
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 346 614 4.0E-16
sp|Q0GGW5|STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus GN=STK11 PE=2 SV=1 380 619 4.0E-16
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 374 581 4.0E-16
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 374 581 4.0E-16
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 346 614 4.0E-16
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 377 588 4.0E-16
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 383 578 4.0E-16
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 389 608 4.0E-16
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 383 601 4.0E-16
sp|Q5AHK2|SSN3_CANAL Serine/threonine-protein kinase SSN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSN3 PE=3 SV=1 435 584 4.0E-16
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 351 614 4.0E-16
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 391 583 4.0E-16
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 386 588 4.0E-16
sp|Q4FCZ5|SSN3_GIBMO Serine/threonine-protein kinase SSN3 OS=Gibberella moniliformis GN=SSN3 PE=1 SV=1 411 584 5.0E-16
sp|Q6BV06|BUR1_DEBHA Serine/threonine-protein kinase BUR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BUR1 PE=3 SV=1 391 585 5.0E-16
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 383 600 5.0E-16
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 391 608 5.0E-16
sp|Q9VP22|CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster GN=Cdk12 PE=1 SV=1 391 607 5.0E-16
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 391 588 5.0E-16
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 387 588 5.0E-16
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 380 588 6.0E-16
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 391 583 6.0E-16
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 383 578 6.0E-16
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 386 588 6.0E-16
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 380 588 6.0E-16
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 384 584 6.0E-16
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 391 605 6.0E-16
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 383 589 6.0E-16
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 383 601 6.0E-16
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 374 581 6.0E-16
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 389 585 6.0E-16
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 376 588 6.0E-16
sp|Q6P3N6|CDK8_XENTR Cyclin-dependent kinase 8 OS=Xenopus tropicalis GN=cdk8 PE=2 SV=1 375 578 7.0E-16
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 335 588 7.0E-16
sp|A2QU77|SSN3_ASPNC Serine/threonine-protein kinase ssn3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ssn3 PE=3 SV=2 411 671 7.0E-16
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 391 608 7.0E-16
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 386 589 7.0E-16
sp|A1CL96|SSN3_ASPCL Serine/threonine-protein kinase ssn3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ssn3 PE=3 SV=2 411 584 7.0E-16
sp|Q55CL6|MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1 386 588 7.0E-16
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 374 581 7.0E-16
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 374 581 8.0E-16
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 386 601 8.0E-16
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 380 591 8.0E-16
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 383 607 8.0E-16
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 356 577 8.0E-16
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 386 577 8.0E-16
sp|Q9FGW5|CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana GN=CDKG1 PE=1 SV=1 381 607 9.0E-16
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 374 581 9.0E-16
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 389 642 9.0E-16
sp|Q8MXI4|PMK2_CAEEL Mitogen-activated protein kinase pmk-2 OS=Caenorhabditis elegans GN=pmk-2 PE=3 SV=1 391 578 9.0E-16
sp|Q39193|SRK2I_ARATH Serine/threonine-protein kinase SRK2I OS=Arabidopsis thaliana GN=SRK2I PE=1 SV=1 391 593 9.0E-16
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 374 581 1.0E-15
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 391 581 1.0E-15
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 391 582 1.0E-15
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 387 588 1.0E-15
sp|Q9VT57|CDK8_DROME Cyclin-dependent kinase 8 OS=Drosophila melanogaster GN=Cdk8 PE=1 SV=2 388 578 1.0E-15
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 384 581 1.0E-15
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 374 575 1.0E-15
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 387 575 1.0E-15
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 380 578 1.0E-15
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 376 588 1.0E-15
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 374 581 1.0E-15
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 389 608 1.0E-15
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 383 578 1.0E-15
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 389 585 1.0E-15
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 374 581 1.0E-15
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 348 577 1.0E-15
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 386 577 1.0E-15
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 388 589 1.0E-15
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 391 598 1.0E-15
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 376 588 1.0E-15
sp|Q9HFF4|PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk1 PE=1 SV=2 387 609 1.0E-15
sp|G5ECH7|CDK5_CAEEL Cyclin-dependent-like kinase 5 OS=Caenorhabditis elegans GN=cdk-5 PE=1 SV=1 384 578 1.0E-15
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 383 582 1.0E-15
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 391 596 1.0E-15
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 391 581 1.0E-15
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 386 577 1.0E-15
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 374 581 1.0E-15
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 391 581 1.0E-15
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 376 588 1.0E-15
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 387 610 1.0E-15
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 375 601 1.0E-15
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 387 577 1.0E-15
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 388 589 1.0E-15
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 386 577 1.0E-15
sp|Q80YP0|CDK3_MOUSE Cyclin-dependent kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2 391 607 1.0E-15
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 391 581 1.0E-15
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 391 609 1.0E-15
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 383 607 2.0E-15
sp|Q4V862|CDK9A_XENLA Cyclin-dependent kinase 9-A OS=Xenopus laevis GN=cdk9-a PE=2 SV=1 369 621 2.0E-15
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 383 610 2.0E-15
sp|Q95NE7|MK14_PANTR Mitogen-activated protein kinase 14 OS=Pan troglodytes GN=MAPK14 PE=2 SV=3 391 578 2.0E-15
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 391 596 2.0E-15
sp|Q8SR90|Y8H9_ENCCU Probable cell division protein kinase ECU11_1290 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1790 PE=3 SV=1 383 618 2.0E-15
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 383 578 2.0E-15
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 376 594 2.0E-15
sp|Q8W4P1|CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2 391 605 2.0E-15
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 388 601 2.0E-15
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 391 608 2.0E-15
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 435 588 2.0E-15
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 389 589 2.0E-15
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 383 578 2.0E-15
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 383 578 2.0E-15
sp|Q7XKA8|SAPK5_ORYSJ Serine/threonine-protein kinase SAPK5 OS=Oryza sativa subsp. japonica GN=SAPK5 PE=2 SV=1 389 596 2.0E-15
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 389 581 2.0E-15
sp|Q7ZX42|CDK9B_XENLA Cyclin-dependent kinase 9-B OS=Xenopus laevis GN=cdk9-b PE=2 SV=1 369 621 2.0E-15
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 383 607 2.0E-15
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 383 607 2.0E-15
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 386 588 2.0E-15
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 378 588 2.0E-15
sp|Q9M9E9|SRK2C_ARATH Serine/threonine-protein kinase SRK2C OS=Arabidopsis thaliana GN=SRK2C PE=1 SV=1 391 591 2.0E-15
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 382 583 2.0E-15
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 379 607 2.0E-15
sp|O44408|KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans GN=kgb-1 PE=1 SV=2 430 608 2.0E-15
sp|Q0CQK1|SSN3_ASPTN Serine/threonine-protein kinase ssn3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ssn3 PE=3 SV=1 383 584 2.0E-15
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 391 578 2.0E-15
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 374 575 2.0E-15
sp|Q5JK68|CDKC2_ORYSJ Cyclin-dependent kinase C-2 OS=Oryza sativa subsp. japonica GN=CDKC-2 PE=2 SV=1 391 578 3.0E-15
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 374 581 3.0E-15
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 388 589 3.0E-15
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 383 578 3.0E-15
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 376 588 3.0E-15
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 373 577 3.0E-15
sp|P38691|KSP1_YEAST Serine/threonine-protein kinase KSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSP1 PE=1 SV=1 444 610 3.0E-15
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 374 581 3.0E-15
sp|Q39192|SRK2D_ARATH Serine/threonine-protein kinase SRK2D OS=Arabidopsis thaliana GN=SRK2D PE=1 SV=1 391 593 3.0E-15
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 380 604 3.0E-15
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 391 578 3.0E-15
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 386 583 3.0E-15
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 386 609 3.0E-15
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 374 581 3.0E-15
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 375 588 3.0E-15
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 374 582 3.0E-15
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 388 589 3.0E-15
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 374 583 3.0E-15
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 389 581 3.0E-15
sp|Q751F5|SSN3_ASHGO Serine/threonine-protein kinase SSN3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSN3 PE=3 SV=2 395 579 3.0E-15
sp|Q6GLD8|CDK9_XENTR Cyclin-dependent kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1 369 621 3.0E-15
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 379 588 3.0E-15
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 386 577 3.0E-15
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 380 601 3.0E-15
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 389 601 4.0E-15
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 326 588 4.0E-15
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 334 595 4.0E-15
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 391 607 4.0E-15
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 442 589 4.0E-15
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 334 595 4.0E-15
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 374 581 4.0E-15
sp|P38147|CHK1_YEAST Serine/threonine-protein kinase CHK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHK1 PE=1 SV=1 387 601 4.0E-15
sp|Q90336|MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio GN=mapk14a PE=1 SV=1 391 578 4.0E-15
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 391 578 4.0E-15
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 389 585 4.0E-15
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 394 589 4.0E-15
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 391 578 4.0E-15
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 391 607 4.0E-15
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 390 584 4.0E-15
sp|Q8R3L8|CDK8_MOUSE Cyclin-dependent kinase 8 OS=Mus musculus GN=Cdk8 PE=2 SV=3 435 578 5.0E-15
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 386 588 5.0E-15
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 386 595 5.0E-15
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 380 588 5.0E-15
sp|P0CS76|SSN3_CRYNJ Serine/threonine-protein kinase SSN3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SSN3 PE=3 SV=1 408 584 5.0E-15
sp|P0CS77|SSN3_CRYNB Serine/threonine-protein kinase SSN3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SSN3 PE=3 SV=1 408 584 5.0E-15
sp|Q4WYR6|SSN3_ASPFU Serine/threonine-protein kinase ssn3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ssn3 PE=3 SV=2 411 584 5.0E-15
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 380 601 5.0E-15
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 381 581 5.0E-15
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 375 588 5.0E-15
sp|Q95YH0|CDK8_DICDI Probable cyclin-dependent kinase 8 OS=Dictyostelium discoideum GN=cdk8 PE=2 SV=1 391 578 5.0E-15
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 349 588 5.0E-15
sp|A1D624|SSN3_NEOFI Serine/threonine-protein kinase ssn3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ssn3 PE=3 SV=1 411 584 6.0E-15
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 375 588 6.0E-15
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 369 621 6.0E-15
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 369 621 6.0E-15
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 386 588 6.0E-15
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 391 679 6.0E-15
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 380 588 6.0E-15
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 389 581 6.0E-15
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 389 591 6.0E-15
sp|Q6BM25|SSN3_DEBHA Serine/threonine-protein kinase SSN3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SSN3 PE=3 SV=2 405 584 6.0E-15
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 380 601 6.0E-15
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 381 578 6.0E-15
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 391 583 6.0E-15
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 380 588 7.0E-15
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 387 581 7.0E-15
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 386 589 7.0E-15
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 380 588 7.0E-15
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 387 582 7.0E-15
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 374 581 7.0E-15
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 383 578 7.0E-15
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 386 644 7.0E-15
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 380 601 7.0E-15
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 388 575 8.0E-15
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 370 621 8.0E-15
sp|Q9DGE2|MK14A_DANRE Mitogen-activated protein kinase 14A OS=Danio rerio GN=mapk14a PE=1 SV=1 391 578 8.0E-15
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 384 577 8.0E-15
sp|Q8BWD8|CDK19_MOUSE Cyclin-dependent kinase 19 OS=Mus musculus GN=Cdk19 PE=2 SV=1 388 578 8.0E-15
sp|Q2TBL8|CDK10_BOVIN Cyclin-dependent kinase 10 OS=Bos taurus GN=CDK10 PE=2 SV=1 381 578 8.0E-15
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 388 575 8.0E-15
sp|P06242|KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN28 PE=1 SV=1 383 584 8.0E-15
sp|Q4KM47|CDK10_RAT Cyclin-dependent kinase 10 OS=Rattus norvegicus GN=Cdk10 PE=2 SV=1 381 578 8.0E-15
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 369 621 9.0E-15
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 376 595 9.0E-15
sp|Q3UMM4|CDK10_MOUSE Cyclin-dependent kinase 10 OS=Mus musculus GN=Cdk10 PE=1 SV=1 381 578 9.0E-15
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 383 578 9.0E-15
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 391 607 9.0E-15
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 383 588 1.0E-14
sp|Q6I5Y0|CDKC1_ORYSJ Cyclin-dependent kinase C-1 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=1 391 578 1.0E-14
sp|Q17IE8|CDK8_AEDAE Cyclin-dependent kinase 8 OS=Aedes aegypti GN=Cdk8 PE=3 SV=2 388 578 1.0E-14
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 384 610 1.0E-14
sp|Q08732|HRK1_YEAST Serine/threonine-protein kinase HRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRK1 PE=1 SV=1 683 764 2.0E-09
sp|Q12100|RTK1_YEAST Probable serine/threonine-protein kinase RTK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTK1 PE=1 SV=1 693 747 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6801
MATRSTADGQQTSPAGGREAASDSGVPQAQRASHNGSSPRNSAPAVRFSSAVQEISPQEPAAATVPTGPNHVSSP
VTADQLQAFTKSLHGRPLQERRMNTFQFEAFSLPPSRVPSHEDDSPDSTRHPTPSSSRLHSPHGSPRLSSLASPP
LTPAGSDPSNQGEKHHRRASGDRSALVNEPSAITPQSTSSHEKSQRSDRIPLPQRPVSSDQVMVRSSSAEGHKGH
RQGMFSVGPGSVPVSREQSPSRASASQLFSRPVIPGADANDPYAKGRRPPPQQNVNRRSIDARFLFSRKKGHGSS
CGSKSTQTEQKRSSGFFGSKSGNESADVGSVHNGSQQGSMADLKRFFRKSDKKRDSSPASSKATSSRLSAQLPFG
EEHGLTSKYGKLGRVLGQGAGGSVRVMKRKEDGTIFAVKEFRARYNHEAERDYNKKVTAEFCIGSTLHHGNIIET
LDIFREKGRWFEVMEFAPYDLFACVMSGRMTREEVKCCFLQILNGVTYLHSVGLAHRDLKLDNVVVSDRGIMKII
DFGSAHVFKYPFEASIDPAQGVVGSDPYLAPEVYESMLYEAQAVDIWSLAIIFCCMTLRRFPWKKPRQTDNSFKL
FCAKPTPEYDPRRLFNMDRGESPSGPSSAASEHAPSSTVAESVPQTPTSTAAPSDNTSMTTPINDSASTLAAPRN
DHVSTPTAPQGDSSTQNKERKDIILGPWRVLRLLPRETRYIIYRMLDINPKTRATMAEIVAEPWVADTVICQQME
DGEVLSASDHGHVLEPPASPGKKSN*
Coding >OphauB2|6801
ATGGCTACTCGGTCGACTGCGGACGGGCAACAAACGAGTCCAGCTGGTGGCCGTGAAGCCGCCTCGGACTCTGGT
GTTCCTCAGGCCCAGCGCGCCAGTCACAATGGCTCCTCGCCTCGCAACAGCGCCCCTGCTGTTCGCTTCTCGTCG
GCCGTACAAGAAATCTCTCCCCAAGAGCCTGCTGCGGCAACGGTGCCGACCGGCCCCAATCATGTGTCGTCGCCA
GTGACTGCCGACCAGCTCCAGGCCTTCACCAAGTCGCTACACGGCCGCCCGCTGCAGGAACGGCGCATGAACACG
TTCCAGTTCGAGGCTTTTTCATTGCCGCCATCGAGGGTGCCCTCTCACGAAGATGACTCTCCTGACTCAACCCGA
CACCCAACACCAAGCTCTTCACGCCTACACTCTCCTCACGGTAGTCCACGGCTCTCGTCACTCGCATCGCCACCC
TTGACTCCAGCCGGATCGGACCCTTCGAACCAAGGTGAAAAACATCACCGCAGAGCTTCCGGGGACCGAAGCGCC
CTTGTCAACGAGCCTTCGGCCATTACGCCACAGTCAACTTCGTCTCACGAAAAGTCGCAAAGAAGCGATCGCATA
CCACTCCCCCAGCGACCTGTGTCGTCGGATCAAGTCATGGTGCGATCGTCATCAGCAGAGGGCCACAAAGGCCAC
CGACAGGGCATGTTCTCGGTCGGGCCTGGCTCCGTGCCGGTTTCGCGGGAACAGAGTCCCTCGAGGGCTTCGGCT
TCGCAACTCTTTTCGCGACCTGTAATTCCAGGCGCCGATGCCAATGACCCTTATGCCAAGGGACGCCGCCCACCG
CCTCAACAAAACGTGAATCGCCGATCTATCGATGCTCGATTTCTCTTTTCCCGCAAGAAGGGCCACGGCTCCTCT
TGTGGTTCCAAGTCGACTCAGACGGAACAGAAGCGAAGCTCAGGTTTCTTTGGGTCAAAGTCTGGAAACGAGTCC
GCCGATGTCGGGTCTGTTCACAATGGCAGCCAGCAAGGCTCCATGGCCGATTTGAAGCGATTTTTTAGAAAGTCG
GACAAGAAGCGTGACTCGTCACCAGCATCAAGCAAGGCGACGAGCTCGCGGCTGAGTGCTCAGCTTCCCTTTGGC
GAAGAGCACGGCTTGACGTCCAAGTACGGCAAGCTGGGCAGAGTGTTGGGCCAAGGAGCTGGTGGCTCAGTTCGT
GTCATGAAGCGCAAGGAAGATGGCACTATTTTTGCCGTCAAGGAGTTCCGAGCGCGCTACAACCACGAAGCTGAG
CGCGACTACAACAAAAAGGTAACTGCCGAATTTTGCATTGGCTCGACGCTGCATCACGGCAACATCATTGAGACA
CTCGACATCTTCCGTGAAAAGGGAAGGTGGTTCGAGGTTATGGAGTTTGCTCCCTATGATTTGTTCGCCTGCGTC
ATGAGTGGACGCATGACACGCGAGGAGGTCAAGTGCTGCTTTTTGCAGATTCTTAATGGAGTGACTTATCTTCAC
AGTGTCGGGCTCGCCCATCGCGATCTCAAGCTCGACAATGTTGTTGTCAGCGACCGCGGCATCATGAAAATCATC
GACTTCGGCAGTGCTCATGTCTTCAAGTATCCCTTTGAAGCCTCGATTGACCCAGCCCAAGGTGTTGTCGGATCC
GATCCCTATCTGGCTCCCGAAGTCTACGAGAGCATGTTGTATGAGGCTCAGGCGGTTGATATCTGGTCCTTGGCT
ATTATCTTTTGCTGCATGACCCTTCGCCGGTTTCCCTGGAAGAAGCCGCGCCAGACGGACAACTCGTTCAAGTTG
TTCTGTGCTAAGCCGACTCCCGAGTACGATCCGCGACGACTCTTCAATATGGATAGAGGAGAATCCCCGAGCGGA
CCATCGAGTGCTGCGTCGGAACATGCACCATCGTCTACTGTGGCGGAAAGCGTTCCGCAGACCCCCACGTCGACA
GCCGCCCCAAGTGACAACACGTCCATGACGACTCCCATCAACGACAGCGCTTCCACATTGGCGGCCCCTCGAAAC
GACCATGTTTCCACGCCTACGGCGCCTCAGGGCGACAGCTCGACACAGAACAAAGAACGCAAGGACATTATTCTC
GGTCCTTGGCGAGTTCTTCGCCTCCTCCCGCGGGAGACGCGATATATCATTTATCGCATGCTCGATATCAACCCC
AAGACTCGCGCGACAATGGCTGAAATTGTGGCTGAGCCTTGGGTCGCTGATACCGTAATTTGCCAGCAGATGGAG
GATGGCGAAGTACTCTCTGCTTCTGACCATGGCCATGTGCTTGAGCCGCCCGCTTCACCTGGCAAGAAGTCCAAC
TAG
Transcript >OphauB2|6801
ATGGCTACTCGGTCGACTGCGGACGGGCAACAAACGAGTCCAGCTGGTGGCCGTGAAGCCGCCTCGGACTCTGGT
GTTCCTCAGGCCCAGCGCGCCAGTCACAATGGCTCCTCGCCTCGCAACAGCGCCCCTGCTGTTCGCTTCTCGTCG
GCCGTACAAGAAATCTCTCCCCAAGAGCCTGCTGCGGCAACGGTGCCGACCGGCCCCAATCATGTGTCGTCGCCA
GTGACTGCCGACCAGCTCCAGGCCTTCACCAAGTCGCTACACGGCCGCCCGCTGCAGGAACGGCGCATGAACACG
TTCCAGTTCGAGGCTTTTTCATTGCCGCCATCGAGGGTGCCCTCTCACGAAGATGACTCTCCTGACTCAACCCGA
CACCCAACACCAAGCTCTTCACGCCTACACTCTCCTCACGGTAGTCCACGGCTCTCGTCACTCGCATCGCCACCC
TTGACTCCAGCCGGATCGGACCCTTCGAACCAAGGTGAAAAACATCACCGCAGAGCTTCCGGGGACCGAAGCGCC
CTTGTCAACGAGCCTTCGGCCATTACGCCACAGTCAACTTCGTCTCACGAAAAGTCGCAAAGAAGCGATCGCATA
CCACTCCCCCAGCGACCTGTGTCGTCGGATCAAGTCATGGTGCGATCGTCATCAGCAGAGGGCCACAAAGGCCAC
CGACAGGGCATGTTCTCGGTCGGGCCTGGCTCCGTGCCGGTTTCGCGGGAACAGAGTCCCTCGAGGGCTTCGGCT
TCGCAACTCTTTTCGCGACCTGTAATTCCAGGCGCCGATGCCAATGACCCTTATGCCAAGGGACGCCGCCCACCG
CCTCAACAAAACGTGAATCGCCGATCTATCGATGCTCGATTTCTCTTTTCCCGCAAGAAGGGCCACGGCTCCTCT
TGTGGTTCCAAGTCGACTCAGACGGAACAGAAGCGAAGCTCAGGTTTCTTTGGGTCAAAGTCTGGAAACGAGTCC
GCCGATGTCGGGTCTGTTCACAATGGCAGCCAGCAAGGCTCCATGGCCGATTTGAAGCGATTTTTTAGAAAGTCG
GACAAGAAGCGTGACTCGTCACCAGCATCAAGCAAGGCGACGAGCTCGCGGCTGAGTGCTCAGCTTCCCTTTGGC
GAAGAGCACGGCTTGACGTCCAAGTACGGCAAGCTGGGCAGAGTGTTGGGCCAAGGAGCTGGTGGCTCAGTTCGT
GTCATGAAGCGCAAGGAAGATGGCACTATTTTTGCCGTCAAGGAGTTCCGAGCGCGCTACAACCACGAAGCTGAG
CGCGACTACAACAAAAAGGTAACTGCCGAATTTTGCATTGGCTCGACGCTGCATCACGGCAACATCATTGAGACA
CTCGACATCTTCCGTGAAAAGGGAAGGTGGTTCGAGGTTATGGAGTTTGCTCCCTATGATTTGTTCGCCTGCGTC
ATGAGTGGACGCATGACACGCGAGGAGGTCAAGTGCTGCTTTTTGCAGATTCTTAATGGAGTGACTTATCTTCAC
AGTGTCGGGCTCGCCCATCGCGATCTCAAGCTCGACAATGTTGTTGTCAGCGACCGCGGCATCATGAAAATCATC
GACTTCGGCAGTGCTCATGTCTTCAAGTATCCCTTTGAAGCCTCGATTGACCCAGCCCAAGGTGTTGTCGGATCC
GATCCCTATCTGGCTCCCGAAGTCTACGAGAGCATGTTGTATGAGGCTCAGGCGGTTGATATCTGGTCCTTGGCT
ATTATCTTTTGCTGCATGACCCTTCGCCGGTTTCCCTGGAAGAAGCCGCGCCAGACGGACAACTCGTTCAAGTTG
TTCTGTGCTAAGCCGACTCCCGAGTACGATCCGCGACGACTCTTCAATATGGATAGAGGAGAATCCCCGAGCGGA
CCATCGAGTGCTGCGTCGGAACATGCACCATCGTCTACTGTGGCGGAAAGCGTTCCGCAGACCCCCACGTCGACA
GCCGCCCCAAGTGACAACACGTCCATGACGACTCCCATCAACGACAGCGCTTCCACATTGGCGGCCCCTCGAAAC
GACCATGTTTCCACGCCTACGGCGCCTCAGGGCGACAGCTCGACACAGAACAAAGAACGCAAGGACATTATTCTC
GGTCCTTGGCGAGTTCTTCGCCTCCTCCCGCGGGAGACGCGATATATCATTTATCGCATGCTCGATATCAACCCC
AAGACTCGCGCGACAATGGCTGAAATTGTGGCTGAGCCTTGGGTCGCTGATACCGTAATTTGCCAGCAGATGGAG
GATGGCGAAGTACTCTCTGCTTCTGACCATGGCCATGTGCTTGAGCCGCCCGCTTCACCTGGCAAGAAGTCCAAC
TAG
Gene >OphauB2|6801
ATGGCTACTCGGTCGACTGCGGACGGGCAACAAACGAGTCCAGCTGGTGGCCGTGGTAAGTCTGATACTCGATGC
GCCTTGTTGCCTGACTTGTGTGTGCGCCTCTGTCTCGACCGACTCTTCCGCGCTCGGCTCTTGAGCATGATTCCC
TGTCTTGACATGGGCGATCTTTAGCTTATTTCTCCGGCCCTGTTTATGCGCGTCGCAAACTCTTTGTTGACAGCT
TGATTTCGCATTTTGGCGTGGTCCGTGGCTAACAGCGTCTTTCCTTGTGCTCTCTTGCCTGGCGCACGATAGAAG
CCGCCTCGGACTCTGGTGTTCCTCAGGCCCAGCGCGCCAGTCACAATGGCTCCTCGCCTCGCAACAGCGCCCCTG
CTGTTCGCTTCTCGTCGGCCGTACAAGAAATCTCTCCCCAAGAGCCTGCTGCGGCAACGGTGCCGACCGGCCCCA
ATCATGTGTCGTCGCCAGTGACTGCCGACCAGCTCCAGGCCTTCACCAAGTCGCTACACGGCCGCCCGCTGCAGG
AACGGCGCATGAACACGTTCCAGTTCGAGGCTTTTTCATTGCCGCCATCGAGGGTACGTTCGGCCTCGTTTGCGT
ATTGCACCTGAAGTGCAATCGCACACTGCTGGGTTCATGATGCTTCCGCGACCATGGATAACTCACCAGCGTCTA
CTTATATTCAGGTGCCCTCTCACGAAGATGACTCTCCTGACTCAACCCGACACCCAACACCAAGCTCTTCACGCC
TACACTCTCCTCACGGTAGTCCACGGCTCTCGTCACTCGCATCGCCACCCTTGACTCCAGCCGGATCGGACCCTT
CGAACCAAGGTGAAAAACATCACCGCAGAGCTTCCGGGGACCGAAGCGCCCTTGTCAACGAGCCTTCGGCCATTA
CGCCACAGTCAACTTCGTCTCACGAAAAGTCGCAAAGAAGCGATCGCATACCACTCCCCCAGCGACCTGTGTCGT
CGGATCAAGTCATGGTGCGATCGTCATCAGCAGAGGGCCACAAAGGCCACCGACAGGGCATGTTCTCGGTCGGGC
CTGGCTCCGTGCCGGTTTCGCGGGAACAGAGTCCCTCGAGGGCTTCGGCTTCGCAACTCTTTTCGCGACCTGTAA
TTCCAGGCGCCGATGCCAATGACCCTTATGCCAAGGGACGCCGCCCACCGCCTCAACAAAACGTGAATCGCCGAT
CTATCGATGCTCGATTTCTCTTTTCCCGCAAGAAGGGCCACGGCTCCTCTTGTGGTTCCAAGTCGACTCAGACGG
AACAGAAGCGAAGCTCAGGTTTCTTTGGGTCAAAGTCTGGAAACGAGTCCGCCGATGTCGGGTCTGTTCACAATG
GCAGCCAGCAAGGCTCCATGGCCGATTTGAAGCGATTTTTTAGAAAGTCGGACAAGAAGCGTGACTCGTCACCAG
CATCAAGCAAGGCGACGAGCTCGCGGCTGAGTGCTCAGCTTCCCTTTGGCGAAGAGCACGGCTTGACGTCCAAGT
ACGGCAAGCTGGGCAGAGTGTTGGGCCAAGGAGCTGGTGGCTCAGTTCGTGTCATGAAGCGCAAGGAAGATGGCA
CTATTTTTGCCGTCAAGGAGTTCCGAGCGCGCTACAACCACGAAGCTGAGCGCGACTACAACAAAAAGGTAACTG
CCGAATTTTGCATTGGCTCGACGCTGCATCACGGCAACATCATTGAGACACTCGACATCTTCCGTGAAAAGGGAA
GGTGGTTCGAGGTTATGGAGTTTGCTCCCTATGATTTGTTCGCCTGCGTCATGAGTGGACGCATGACACGCGAGG
AGGTCAAGTGCTGCTTTTTGCAGATTCTTAATGGAGTGACTTATCTTCACAGTGTCGGGCTCGCCCATCGCGATC
TCAAGCTCGACAATGTTGTTGTCAGCGACCGCGGCATCATGAAAATCATCGACTTCGGCAGTGCTCATGTCTTCA
AGTATCCCTTTGAAGCCTCGATTGACCCAGCCCAAGGTGAGTACTTTGAGTGTGCACCCAATGCGCTTGCGGCAA
AGCTGAGACATAACCCCCTTTCAGGTGTTGTCGGATCCGATCCCTATCTGGCTCCCGAAGTCTACGAGAGCATGT
TGTATGAGGCTCAGGCGGTTGATATCTGGTCCTTGGCTATTATCTTTTGCTGCATGACCCTTCGCCGGTTTCCCT
GGAAGAAGCCGCGCCAGACGGACAACTCGTTCAAGTTGTTCTGTGCTAAGCCGACTCCCGAGTACGATCCGCGAC
GACTCTTCAATATGGATAGAGGTAAGGGCAAAGCTTTTGAGGTGCCGGCGCCAATGCCGGTGCCCATGGCCATGG
CCATGCTAGTCGAGGCTTCTGCTCGTTCATCCACGAGCAGCCTAGTTTTGAAACCCGCTGACTACTGTCACATTA
TCTCTCCAGGAGAATCCCCGAGCGGACCATCGAGTGCTGCGTCGGAACATGCACCATCGTCTACTGTGGCGGAAA
GCGTTCCGCAGACCCCCACGTCGACAGCCGCCCCAAGTGACAACACGTCCATGACGACTCCCATCAACGACAGCG
CTTCCACATTGGCGGCCCCTCGAAACGACCATGTTTCCACGCCTACGGCGCCTCAGGGCGACAGCTCGACACAGA
ACAAAGGTGAGGGAAGCGCCTGGTGCCGCTGCGCCATGCATCTTCTCGATAACCTTGACACTGTGAGACTGATTC
CCGAGCCTGAGCCAGAACGCAAGGACATTATTCTCGGTCCTTGGCGAGTTCTTCGCCTCCTCCCGCGGGAGACGC
GATATATCATTTATCGCATGCTCGATATCAACCCCAAGACTCGCGCGACAATGGCTGAAATTGTGGCTGAGCCTT
GGGTCGCTGATACCGTAATTTGCCAGCAGATGGAGGATGGCGAAGTACTCTCTGCTTCTGACCATGGCCATGTGC
TTGAGCCGCCCGCTTCACCTGGCAAGAAGTCCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail