Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6796
Gene name
LocationContig_66:10913..13337
Strand-
Gene length (bp)2424
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 2.7E-06 166 205
PF00564 PB1 PB1 domain 7.7E-10 518 585
PF00787 PX PX domain 9.1E-09 353 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40996|SCD2_SCHPO Protein scd2/ral3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scd2 PE=3 SV=1 14 594 4.0E-86
sp|P29366|BEM1_YEAST Bud emergence protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM1 PE=1 SV=1 27 550 4.0E-60
sp|Q5TCZ1|SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens GN=SH3PXD2A PE=1 SV=1 344 444 9.0E-13
sp|O89032|SPD2A_MOUSE SH3 and PX domain-containing protein 2A OS=Mus musculus GN=Sh3pxd2a PE=1 SV=2 344 444 1.0E-12
sp|A2AAY5|SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus GN=Sh3pxd2b PE=1 SV=1 344 444 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40996|SCD2_SCHPO Protein scd2/ral3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scd2 PE=3 SV=1 14 594 4.0E-86
sp|P29366|BEM1_YEAST Bud emergence protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BEM1 PE=1 SV=1 27 550 4.0E-60
sp|Q5TCZ1|SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens GN=SH3PXD2A PE=1 SV=1 344 444 9.0E-13
sp|O89032|SPD2A_MOUSE SH3 and PX domain-containing protein 2A OS=Mus musculus GN=Sh3pxd2a PE=1 SV=2 344 444 1.0E-12
sp|A2AAY5|SPD2B_MOUSE SH3 and PX domain-containing protein 2B OS=Mus musculus GN=Sh3pxd2b PE=1 SV=1 344 444 2.0E-12
sp|A1X283|SPD2B_HUMAN SH3 and PX domain-containing protein 2B OS=Homo sapiens GN=SH3PXD2B PE=1 SV=3 344 444 2.0E-12
sp|Q1LYG0|SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio GN=sh3pxd2a PE=3 SV=2 344 444 3.0E-09
sp|O77774|NCF1_BOVIN Neutrophil cytosol factor 1 OS=Bos taurus GN=NCF1 PE=2 SV=1 344 472 2.0E-08
sp|F1M707|NCF1_RAT Neutrophil cytosolic factor 1 OS=Rattus norvegicus GN=Ncf1 PE=1 SV=2 344 447 2.0E-08
sp|Q09014|NCF1_MOUSE Neutrophil cytosol factor 1 OS=Mus musculus GN=Ncf1 PE=1 SV=3 344 447 9.0E-08
sp|P14598|NCF1_HUMAN Neutrophil cytosol factor 1 OS=Homo sapiens GN=NCF1 PE=1 SV=3 344 447 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0035091 phosphatidylinositol binding Yes
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0005488 binding No
GO:0008289 lipid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6796
MKALRRSMKGDKHKQSPSIGSKSAFAIVPPKKVIRAIDDYHPDDDLVQSFAKAGVQVLGFSKGDFFHVIGREDDA
RWYEACNPALPDARGLVPVDLFQVLGRNERDSAQSDGSKTPIIKSPDHDSGYGDTTAPPLPPVPSQRTSRSMRPA
GTVYAKVRYAFTTLTQRPDELSAEEGENLIIVAQSNHEWVIAKPIMRLGGPGLIPISFIDVFDEPPLGTDPNNPP
TPVGDPLEALRRAGVPSVEDWKQMAAQYKNSSITLGKFDGVSSPTSHQPGIEQGMSGLSLQSGGRQSHQNGSRNH
GYHNYSASGQHSIPGDSSAGGSPPHMPAPVMARIPRYCFGEDKYWFVIEAKLEDGRCWELSRYYQDFYDFQIALL
AEFPAEAGNTSTQKRTLPYMPGPVNYVTDAITEGRLYNLDAYIKNLLNQPPHISRCDLVKLFFKPREGDYEIDPG
AFGDDEYRMSESSHQSSAESPGNAASVKSSSLTSNGYSYSGLSPASRPGGGHPQGMAAPQEQAPVTAMKIKVRYK
EDVFAMRVATDIIFEDLFDKVQERIKAAPGEDIALFYLDEQSSTLQSLASTEDLDLALQRNEKLTIYCEVA*
Coding >OphauB2|6796
ATGAAGGCCCTGCGGCGCTCTATGAAGGGCGACAAGCACAAGCAAAGCCCCTCCATCGGCTCCAAATCCGCCTTT
GCTATTGTGCCGCCCAAAAAGGTTATCCGCGCCATCGACGACTATCACCCCGATGACGATCTGGTCCAGAGCTTT
GCCAAGGCCGGCGTCCAGGTCCTTGGTTTTTCCAAGGGTGATTTTTTCCACGTCATTGGCCGCGAAGACGATGCC
CGATGGTACGAGGCCTGTAATCCAGCGCTGCCAGATGCCCGTGGACTTGTCCCCGTCGATCTCTTCCAGGTGCTT
GGACGCAACGAGAGGGACAGCGCACAGTCTGATGGCAGCAAAACGCCCATCATTAAAAGCCCCGACCACGATTCC
GGCTATGGCGACACGACGGCACCACCCCTACCCCCCGTTCCCTCTCAGCGTACCTCGAGGTCCATGAGGCCCGCC
GGCACAGTTTACGCCAAGGTTCGCTACGCCTTCACCACCCTTACCCAGCGACCAGACGAGCTGTCGGCAGAGGAG
GGCGAGAACCTCATTATTGTCGCACAATCAAATCACGAATGGGTCATTGCCAAGCCTATTATGCGATTAGGCGGT
CCCGGCCTGATCCCCATTAGCTTTATCGATGTTTTTGACGAGCCGCCGCTGGGCACGGATCCGAATAATCCTCCG
ACGCCAGTTGGCGATCCATTGGAGGCACTGCGCAGAGCTGGTGTGCCCTCTGTCGAGGACTGGAAGCAGATGGCA
GCCCAGTACAAGAATAGTAGCATTACGCTCGGCAAATTTGACGGAGTCAGCTCTCCAACCAGCCATCAGCCTGGC
ATCGAACAGGGCATGTCTGGCTTGAGTTTGCAATCTGGTGGGCGACAAAGCCATCAAAATGGATCTCGGAATCAT
GGATACCACAATTACTCTGCATCGGGCCAGCACTCCATTCCCGGAGACTCGAGCGCCGGAGGCTCACCCCCACAC
ATGCCAGCACCAGTCATGGCACGGATACCACGGTACTGCTTTGGCGAGGACAAGTATTGGTTTGTCATTGAGGCA
AAACTCGAGGACGGCCGATGCTGGGAGCTCTCACGTTACTACCAAGATTTTTACGACTTCCAAATTGCTCTTCTG
GCCGAATTCCCTGCCGAAGCTGGCAACACGAGCACGCAGAAGCGAACTTTGCCATATATGCCCGGCCCCGTTAAC
TATGTGACCGATGCCATAACCGAGGGTCGCCTCTATAACTTGGATGCCTACATCAAGAACCTCCTCAACCAGCCA
CCCCACATCTCTCGCTGCGATCTTGTCAAGCTCTTCTTCAAGCCACGCGAAGGCGACTACGAGATTGACCCTGGT
GCCTTTGGCGACGACGAGTACCGAATGTCGGAAAGCTCGCACCAGTCCTCGGCAGAGTCACCTGGAAATGCCGCT
TCTGTCAAATCTTCGTCATTGACTTCGAATGGCTATAGCTATTCGGGCTTATCTCCGGCTTCGAGGCCTGGAGGT
GGTCATCCTCAAGGCATGGCAGCGCCACAGGAGCAGGCTCCTGTGACAGCAATGAAGATCAAGGTTCGCTACAAG
GAGGATGTCTTTGCCATGCGCGTCGCCACGGATATCATTTTTGAAGACTTGTTCGACAAGGTCCAAGAACGAATC
AAAGCTGCTCCCGGCGAGGACATTGCTCTGTTCTACCTCGATGAACAGTCGTCAACCCTTCAAAGTCTGGCAAGC
ACCGAAGATTTGGATCTTGCTCTGCAGCGAAACGAGAAGCTCACGATATACTGTGAAGTGGCTTAA
Transcript >OphauB2|6796
ATGAAGGCCCTGCGGCGCTCTATGAAGGGCGACAAGCACAAGCAAAGCCCCTCCATCGGCTCCAAATCCGCCTTT
GCTATTGTGCCGCCCAAAAAGGTTATCCGCGCCATCGACGACTATCACCCCGATGACGATCTGGTCCAGAGCTTT
GCCAAGGCCGGCGTCCAGGTCCTTGGTTTTTCCAAGGGTGATTTTTTCCACGTCATTGGCCGCGAAGACGATGCC
CGATGGTACGAGGCCTGTAATCCAGCGCTGCCAGATGCCCGTGGACTTGTCCCCGTCGATCTCTTCCAGGTGCTT
GGACGCAACGAGAGGGACAGCGCACAGTCTGATGGCAGCAAAACGCCCATCATTAAAAGCCCCGACCACGATTCC
GGCTATGGCGACACGACGGCACCACCCCTACCCCCCGTTCCCTCTCAGCGTACCTCGAGGTCCATGAGGCCCGCC
GGCACAGTTTACGCCAAGGTTCGCTACGCCTTCACCACCCTTACCCAGCGACCAGACGAGCTGTCGGCAGAGGAG
GGCGAGAACCTCATTATTGTCGCACAATCAAATCACGAATGGGTCATTGCCAAGCCTATTATGCGATTAGGCGGT
CCCGGCCTGATCCCCATTAGCTTTATCGATGTTTTTGACGAGCCGCCGCTGGGCACGGATCCGAATAATCCTCCG
ACGCCAGTTGGCGATCCATTGGAGGCACTGCGCAGAGCTGGTGTGCCCTCTGTCGAGGACTGGAAGCAGATGGCA
GCCCAGTACAAGAATAGTAGCATTACGCTCGGCAAATTTGACGGAGTCAGCTCTCCAACCAGCCATCAGCCTGGC
ATCGAACAGGGCATGTCTGGCTTGAGTTTGCAATCTGGTGGGCGACAAAGCCATCAAAATGGATCTCGGAATCAT
GGATACCACAATTACTCTGCATCGGGCCAGCACTCCATTCCCGGAGACTCGAGCGCCGGAGGCTCACCCCCACAC
ATGCCAGCACCAGTCATGGCACGGATACCACGGTACTGCTTTGGCGAGGACAAGTATTGGTTTGTCATTGAGGCA
AAACTCGAGGACGGCCGATGCTGGGAGCTCTCACGTTACTACCAAGATTTTTACGACTTCCAAATTGCTCTTCTG
GCCGAATTCCCTGCCGAAGCTGGCAACACGAGCACGCAGAAGCGAACTTTGCCATATATGCCCGGCCCCGTTAAC
TATGTGACCGATGCCATAACCGAGGGTCGCCTCTATAACTTGGATGCCTACATCAAGAACCTCCTCAACCAGCCA
CCCCACATCTCTCGCTGCGATCTTGTCAAGCTCTTCTTCAAGCCACGCGAAGGCGACTACGAGATTGACCCTGGT
GCCTTTGGCGACGACGAGTACCGAATGTCGGAAAGCTCGCACCAGTCCTCGGCAGAGTCACCTGGAAATGCCGCT
TCTGTCAAATCTTCGTCATTGACTTCGAATGGCTATAGCTATTCGGGCTTATCTCCGGCTTCGAGGCCTGGAGGT
GGTCATCCTCAAGGCATGGCAGCGCCACAGGAGCAGGCTCCTGTGACAGCAATGAAGATCAAGGTTCGCTACAAG
GAGGATGTCTTTGCCATGCGCGTCGCCACGGATATCATTTTTGAAGACTTGTTCGACAAGGTCCAAGAACGAATC
AAAGCTGCTCCCGGCGAGGACATTGCTCTGTTCTACCTCGATGAACAGTCGTCAACCCTTCAAAGTCTGGCAAGC
ACCGAAGATTTGGATCTTGCTCTGCAGCGAAACGAGAAGCTCACGATATACTGTGAAGTGGCTTAA
Gene >OphauB2|6796
ATGAAGGTTGGCCGCCTTTGCCTCTTGTTATGCGTCTGCTCATGCCCCTTCGTCCTTCCTGTCAAGCCATGGCTG
TATTTGGGCCTGCGTCATCAGCGTTGCGCTCGCCTTCACGCTTGCCTTGTCCTGCCATCATTGTCCCTTCCAATT
CCCTTGATCGGCGCACCCAAGAATTTCTCGCCAACCATCTTCCTTTCCCTTCCCCGCACCTTGATTCACCTCGCA
TCGCCAACAAAAAGCTCTCATTTCCTTTCTTTTGTGTGTGCCTGACCCACGGCTGACCGTTATGGAACTCGTCAA
GGCCCTGCGGCGCTCTATGAAGGGCGACAAGCACAAGCAAAGCCCCTCCATCGGCTCCAAATCCGCCTTTGCTAT
TGTGCCGCCCAAAAAGGTTCGTGGCTCGCCTTGATCCCCTTGCTCCCCGCTGCCCATCCATTTTGCCATCAAGCG
CCCCATCTGTGCCGACCGTGCATATTTTGGAAACCCTGTTGGCGCGCGGCACTCGGCTTAGCACCCTGTTCATGT
CGTTGGCTCGGCATGTCGTTTTCGGCTTACACATGATAACCCTGGGTGTGACGTGATGCAAGCCCACTGCTAACT
TTGATTTCGCTGCAGGTTATCCGCGCCATCGACGACTATCACCCCGATGACGATCTGGTCCAGAGCTTTGCCAAG
GCCGGCGTCCAGGTCCTTGGTTTTTCCAAGGGTGATTTTTTCCACGTCATTGGCCGCGAAGACGATGCCCGATGG
TACGAGGCCTGTAATCCAGCGCTGCCAGATGCCCGTGGACTTGTCCCCGTCGATCTCTTCCAGGTGCTTGGACGC
AACGAGAGGGACAGCGCACAGTCTGATGGCAGCAAAACGCCCATCATTAAAAGCCCCGACCACGATTCCGGCTAT
GGCGACACGACGGCACCACCCCTACCCCCCGTTCCCTCTCAGCGTACCTCGAGGTCCATGAGGCCCGCCGGCACA
GTTTACGCCAAGGTTCGCTACGCCTTCACCACCCTTACCCAGCGACCAGACGAGCTGTCGGCAGAGGAGGGCGAG
AACCTCATTATTGTCGCACAATCAAATCACGAATGGGTCATTGCCAAGCCTATTATGCGATTAGGCGGTCCCGGC
CTGATCCCCATTAGCTTTATCGATGTTTTTGACGAGCCGCCGCTGGGCACGGATCCGAATAATCCTCCGACGCCA
GTTGGCGATCCATTGGAGGCACTGCGCAGAGCTGGTGTGCCCTCTGTCGAGGACTGGAAGCAGATGGCAGCCCAG
TACAAGAATAGTAGCATTACGCTCGGCAAATTTGACGGAGTCAGCTCTCCAACCAGCCATCAGCCTGGCATCGAA
CAGGGCATGTCTGGCTTGAGTTTGCAATCTGGTGGGCGACAAAGCCATCAAAATGGATCTCGGGTAGGCAGGCTT
TCCATGCTTGGCAGACTTGTCGCAATAGACTGACCTCAACCTGGTAACAGAATCATGGATACCACAATTACTCTG
CATCGGGCCAGCACTCCATTCCCGGAGACTCGAGCGCCGGAGGCTCACCCCCACACATGCCAGCACCAGTCATGG
CACGGATACCACGGTACTGCTTTGGCGAGGACAAGTATTGGTTTGTCATTGAGGCAAAACTCGAGGACGGCCGAT
GCTGGGAGCTCTCACGTTACTACCAAGATTTTTACGACTTCCAAATTGCTCTTCTGGCCGAATTCCCTGCCGAAG
CTGGCAACACGAGCACGCAGAAGCGAACTTTGCCATATATGCCCGGCCCCGTTAACTATGTGACCGATGCCATAA
CCGAGGGTCGCCTCTATAACTTGGATGCCTACATCAAGAACCTCCTCAACCAGCCACCCCACATCTCTCGCTGCG
ATCTTGTCAAGCTCTTCTTCAAGCCACGCGAAGGCGACTACGAGATTGACCCTGGTGCCTTTGGCGACGACGAGT
ACCGAATGTCGGAAAGCTCGCACCAGTCCTCGGCAGAGTCACCTGGAAATGCCGCTTCTGTCAAATCTTCGTCAT
TGACTTCGAATGGCTATAGCTATTCGGGCTTATCTCCGGCTTCGAGGCCTGGAGGTGGTCATCCTCAAGGTTAGT
CTCATATCCCCGATTCAAACCGGCATAATGACTGATTAAGCTATAGGCATGGCAGCGCCACAGGAGCAGGCTCCT
GTGACAGCAATGAAGATCAAGGTTCGCTACAAGGAGGATGTCTTTGCCATGCGCGTCGCCACGGATATCATTTTT
GAAGACTTGTTCGACAAGGTCCAAGAACGAATCAAAGCTGCTCCCGGCGAGGACATTGCTCTGTTCTACCTCGAT
GAACAGTCGTCAACCCTTCAAAGTCTGGCAAGCACCGAAGATTTGGATCTTGCTCTGCAGCGAAACGAGAAGCTC
ACGATATACTGTGAAGTGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail