Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6793
Gene name
LocationContig_66:62..4880
Strand-
Gene length (bp)4818
Transcript length (bp)4524
Coding sequence length (bp)4524
Protein length (aa) 1508

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14701 hDGE_amylase Glycogen debranching enzyme, glucanotransferase domain 2.9E-176 146 585
PF06202 GDE_C Amylo-alpha-1,6-glucosidase 6.4E-91 1105 1494
PF14702 hGDE_central Central domain of human glycogen debranching enzyme 3.8E-88 758 1002
PF14699 hGDE_N N-terminal domain from the human glycogen debranching enzyme 9.1E-29 41 142

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06625|GDE_YEAST Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDB1 PE=1 SV=1 13 1499 0.0E+00
sp|Q2PQH8|GDE_CANLF Glycogen debranching enzyme OS=Canis lupus familiaris GN=AGL PE=2 SV=1 56 1499 0.0E+00
sp|P35574|GDE_RABIT Glycogen debranching enzyme OS=Oryctolagus cuniculus GN=AGL PE=1 SV=1 56 1499 0.0E+00
sp|A8BQB4|GDE_HORSE Glycogen debranching enzyme OS=Equus caballus GN=AGL PE=2 SV=1 133 1499 0.0E+00
sp|P35573|GDE_HUMAN Glycogen debranching enzyme OS=Homo sapiens GN=AGL PE=1 SV=3 133 1499 0.0E+00

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6793
MSPRIMTSTEVYLLPLNDNGSPDVAGEYIYLTPRSSDAITVRFAIEGTSSVCRHGSLWVNIPERGVEFRRHSFRQ
FELNPDFNRTIEVSVPIYHPGAFAFYLSYAELPRLEARLAAEPAEPDEKHLTKTPLYYIDVAPRLQLDGRPLPLP
ALSIFSVIGKLMGKYPIDWERHLRSIADRGYNMIHFTPLQQRGDSNSPFSLYDQLAWDPQCFPRGEADVQDLVDS
MEQKHSLLSLTDVVLNHTANNSKWLQQHPEAGYNLSTAPWLESAYELDTKLLELSDKLQSMGLPVDIKSTDDLLR
IMDAVKDVIGKIRLWEYYALDLDGNVDSAVDYWVQNKTSNVDVSETTVNKLKNGSAEDEAAFVKEFGLHGLDRLG
ERFRRRIDPAVAATLLSFSLGRFDSRDGSAPDKAAAKARILEVVNALNVDLYKEYDGDIKEILDQLYNRIKYMRL
DDHGPKLGPINEKNPLIETYFTRLPSNKTTSCHKPGDLALVNNGWVWAGNALVDNAGPDSRVYLRREVIVWGDCV
KLRYGSGPEDSPWLWKHMTAYARMLAKLFNGFRIDNCHSTPIHVAEYILDEARRVRPDLYIVAELFTGSEEMDYV
FVKRLGISSLVREAMQAWSTAELSRLVHKHGGRPIGSFEVDEVTRLDASSSSTSLSSLSQRTCNGSLCREIVRRI
KPTPVHALFMDCTHDNEMPAQKRDARDTLPNAALVNMCSSATGSVVGYDEIYPRLVDLVGEKRLYLPWTSSSPQK
PGSYSNKGIGGIKKLLNQIHTLMGKDGYDETHIHHEDEYITVHRVHPKSRKGYFLIAHTAFPGYGNGNGNFSPVR
LTGTRVDHLGSWTLEVDSSAEAVKRTLADPKYLKGLPSRVLDVEGVDVEIQSDTTVISVHENFPPGSIALFETWI
PTAEHSVGLDTFVTSGAKAAWDQLDLIDLNFVMYRCEAEELDWSRGRDGTYHVPNHGKLVYAGLQGWWSVLGKVI
RENNLGHALCQNLRDGKWALDYIVGRLERMSKTAGNERLSQPAKWLKERFDAIRTIPSFLLPRYFGLVLRTAYLA
SWDRAMELMNSNVSGGQWFLQSLAMVSVQQTGYVKCWGRDVFISIRGLFLGTGRGDAPRYNSRDSIWFFLQAIQD
YVYFAPEGVALLQERVKRRFLPYDDTWFPTSDARAYSEESSIEEVIQEALQRHASGIKFREANAGPQIDSQMKDQ
GFSQEIKVDWQTGIIFGGNQFNCGTWMDKMGESSRAGSKGIPGTPRDGAAIEITGLLYSTLAWLASMHKEQKYAY
SGVEAADGTSVTFASWADRIKANFERCYYVPQTPQDDGAYDVNAKVINRRGIYKDLYRSGKEYEDYQLRPNFAIA
MTVAPRLFDARHAMAALCTADAVLRGPTGMATLDPADLNYRPYYRNSDDGDDFATARGRNYHQGPEWLWPMGFFL
RALLKFDLARRTAAQGRIEAFQQVTRRLGGCKRMMRESAWAGLTELTQKKGEYCPDSSPTQAWSAGCLIDLYMDA
LQEQQHD*
Coding >OphauB2|6793
ATGAGCCCGCGAATAATGACGTCCACCGAGGTTTATTTGCTGCCGCTCAACGACAATGGTTCTCCCGATGTTGCT
GGCGAATACATATATTTGACGCCCAGGTCAAGCGATGCCATTACTGTTCGCTTCGCGATTGAGGGCACCTCGTCG
GTTTGTCGCCATGGCAGCCTCTGGGTCAATATTCCTGAGCGGGGTGTCGAGTTTCGTCGCCATAGCTTCAGGCAG
TTTGAGCTGAATCCAGATTTCAACCGCACAATCGAAGTCTCAGTACCCATTTACCACCCGGGCGCTTTTGCTTTT
TACCTTAGCTACGCTGAGCTGCCTCGTCTGGAAGCGCGCCTTGCGGCAGAGCCGGCGGAACCCGACGAGAAGCAC
CTAACCAAGACTCCTCTCTACTATATTGATGTCGCTCCCAGGTTGCAGCTCGACGGCCGTCCGCTGCCCTTGCCT
GCTCTCTCCATTTTTTCCGTCATTGGGAAACTCATGGGAAAGTACCCCATCGATTGGGAGAGGCACCTGCGCAGC
ATTGCCGATCGGGGCTACAACATGATTCATTTCACGCCCCTTCAGCAACGAGGCGATTCCAACTCGCCCTTTAGC
TTGTACGACCAGCTGGCTTGGGACCCTCAGTGCTTTCCTCGTGGCGAGGCCGATGTGCAGGACTTGGTTGACAGC
ATGGAGCAAAAGCACTCTCTTCTTAGTCTCACTGATGTTGTCTTGAACCACACGGCGAATAACTCAAAGTGGCTC
CAGCAGCATCCAGAAGCCGGATACAACCTTTCGACTGCCCCATGGCTGGAATCTGCCTACGAGCTTGACACCAAA
CTCCTTGAGCTTAGCGACAAGTTGCAGTCAATGGGGCTTCCAGTTGACATCAAGTCCACGGATGATTTACTACGC
ATCATGGATGCCGTCAAGGACGTTATTGGCAAGATTCGCCTATGGGAATACTATGCCCTTGACCTTGATGGCAAC
GTCGACTCTGCTGTGGACTATTGGGTTCAGAATAAGACTTCCAACGTTGACGTGTCAGAGACAACGGTCAACAAG
CTTAAGAATGGATCCGCCGAGGACGAGGCTGCTTTTGTAAAAGAGTTTGGCTTGCATGGTCTGGACCGTCTCGGA
GAGCGATTTAGGCGAAGAATCGATCCAGCCGTGGCAGCTACCCTCTTGTCCTTTTCTCTCGGTCGTTTTGATAGC
CGAGATGGCAGCGCACCCGACAAGGCTGCAGCAAAGGCGCGGATCCTGGAAGTGGTGAATGCCCTCAATGTCGAC
CTTTACAAGGAATATGATGGTGATATCAAGGAGATTTTGGATCAGCTTTACAATCGCATCAAGTACATGCGTCTG
GATGACCACGGCCCCAAACTCGGTCCAATCAATGAAAAGAATCCTCTAATAGAGACATACTTTACCCGACTGCCC
TCAAACAAGACGACGTCTTGTCATAAACCAGGGGACTTGGCGCTGGTCAATAATGGCTGGGTATGGGCGGGCAAC
GCGCTCGTCGACAATGCGGGCCCCGACTCTAGAGTTTACTTGAGGCGCGAAGTCATTGTCTGGGGAGACTGTGTC
AAGCTACGATATGGCTCGGGTCCCGAGGACAGCCCCTGGTTGTGGAAGCACATGACTGCCTATGCGCGCATGCTG
GCCAAGTTGTTTAATGGCTTTCGCATTGACAATTGTCATTCCACTCCTATCCACGTGGCTGAATATATACTTGAC
GAAGCACGCCGTGTACGCCCCGACTTGTACATTGTGGCTGAGCTTTTTACTGGATCAGAAGAAATGGACTATGTC
TTTGTCAAGCGACTTGGAATTAGCTCGCTGGTGCGCGAAGCGATGCAGGCTTGGAGTACTGCAGAACTCAGCAGA
TTGGTTCACAAGCACGGCGGGCGCCCCATTGGCAGCTTCGAGGTGGACGAGGTTACACGCTTGGACGCAAGCTCT
TCGTCGACCAGTCTGTCGAGTTTGAGCCAACGCACATGCAATGGCTCACTCTGCAGGGAGATTGTCAGAAGAATC
AAGCCTACTCCTGTCCACGCACTCTTTATGGACTGCACTCATGACAATGAGATGCCTGCACAGAAGCGAGACGCA
AGAGATACTCTGCCTAATGCAGCGCTTGTCAATATGTGTTCGAGTGCCACGGGCAGCGTCGTGGGCTATGACGAG
ATTTATCCTCGGCTGGTTGACTTGGTTGGCGAGAAGCGGTTGTATCTACCGTGGACGAGTTCTAGTCCACAAAAG
CCTGGCAGCTACAGCAACAAGGGCATTGGTGGAATCAAGAAGCTCCTTAACCAGATTCACACACTAATGGGCAAG
GATGGTTATGATGAAACACACATTCATCATGAAGATGAGTATATCACGGTTCACAGGGTGCACCCCAAATCCCGC
AAGGGCTACTTCCTCATTGCACACACGGCATTTCCGGGATATGGCAACGGCAACGGAAACTTTAGCCCTGTGCGC
CTGACTGGTACACGGGTAGACCACTTGGGAAGTTGGACGCTCGAGGTAGACTCGAGTGCAGAGGCTGTCAAGCGG
ACCCTGGCAGACCCAAAATATCTCAAGGGTCTTCCAAGCCGCGTCTTGGACGTGGAAGGCGTCGACGTTGAAATA
CAGAGCGACACCACAGTTATTAGTGTCCATGAGAACTTCCCACCTGGGAGCATTGCTCTTTTTGAGACTTGGATA
CCGACGGCAGAGCACTCTGTTGGTTTGGATACCTTTGTCACTTCGGGCGCAAAGGCGGCGTGGGACCAGCTCGAC
TTGATTGACCTCAACTTTGTCATGTATCGCTGCGAGGCCGAGGAGCTGGACTGGAGCAGGGGACGAGATGGCACG
TATCATGTTCCCAACCATGGCAAGCTTGTGTATGCTGGCCTACAAGGGTGGTGGAGTGTTCTCGGCAAGGTGATT
CGGGAAAACAATTTGGGCCATGCCCTGTGCCAGAACCTTCGAGACGGCAAGTGGGCTCTGGACTATATTGTTGGG
CGTCTTGAGCGCATGAGCAAGACTGCGGGTAACGAGCGTCTATCCCAACCGGCAAAATGGCTCAAGGAGCGCTTT
GATGCCATTCGCACTATTCCCAGCTTTCTTCTACCAAGATACTTTGGCTTAGTGTTGCGCACTGCCTACCTTGCC
AGCTGGGACCGGGCCATGGAGTTGATGAACAGCAACGTGTCGGGAGGGCAGTGGTTCTTGCAGAGCCTGGCCATG
GTTAGCGTACAACAAACCGGATACGTCAAGTGCTGGGGGCGCGACGTCTTCATCTCCATTCGCGGCTTATTTCTC
GGCACTGGGCGTGGCGATGCGCCGCGATACAACTCGCGAGACTCCATCTGGTTCTTTTTGCAGGCCATTCAAGAC
TATGTCTACTTTGCCCCCGAGGGAGTGGCTTTGCTGCAAGAAAGGGTGAAGCGACGGTTCTTGCCATACGATGAC
ACGTGGTTCCCGACGAGCGATGCGAGGGCTTACTCTGAGGAAAGCTCGATTGAGGAGGTGATTCAGGAAGCCCTT
CAACGGCATGCCTCGGGCATCAAGTTTCGCGAGGCAAATGCTGGGCCGCAGATTGACTCTCAGATGAAGGACCAA
GGTTTCAGCCAGGAAATCAAGGTGGACTGGCAAACGGGCATCATTTTTGGCGGCAACCAGTTCAACTGCGGCACG
TGGATGGACAAGATGGGAGAGAGCTCGCGGGCCGGCTCCAAGGGGATCCCCGGGACTCCGCGCGACGGGGCGGCC
ATTGAGATTACCGGGCTGCTCTACAGCACGCTGGCATGGCTGGCGTCGATGCACAAGGAGCAAAAGTATGCCTAC
TCTGGAGTCGAGGCTGCCGACGGCACGTCTGTGACATTTGCGAGCTGGGCGGACCGCATCAAGGCCAATTTTGAG
CGATGCTACTATGTTCCGCAGACGCCGCAAGACGACGGCGCCTACGACGTGAATGCCAAAGTGATCAACCGGCGC
GGCATCTACAAGGACCTGTACCGCTCGGGCAAGGAGTACGAAGACTACCAGCTGCGCCCCAACTTTGCCATTGCC
ATGACGGTGGCGCCTCGGCTCTTTGACGCGCGGCACGCCATGGCGGCGCTGTGCACAGCGGATGCAGTGCTGCGC
GGGCCGACGGGCATGGCGACGCTGGACCCGGCCGACTTGAACTACCGGCCCTATTACCGCAACAGCGACGACGGC
GACGACTTTGCAACGGCACGCGGGCGCAACTACCACCAGGGGCCCGAGTGGCTATGGCCCATGGGCTTTTTCTTG
CGCGCCCTCCTAAAGTTTGACTTGGCGAGGCGGACGGCGGCGCAGGGGCGCATCGAGGCCTTTCAGCAGGTGACG
CGCCGGCTGGGCGGCTGTAAGCGCATGATGAGGGAGAGTGCCTGGGCTGGACTGACGGAGCTGACGCAAAAGAAG
GGCGAATACTGTCCCGACTCTAGCCCGACACAGGCGTGGTCGGCGGGCTGCCTCATTGACTTGTACATGGATGCC
CTGCAAGAGCAGCAGCACGATTAG
Transcript >OphauB2|6793
ATGAGCCCGCGAATAATGACGTCCACCGAGGTTTATTTGCTGCCGCTCAACGACAATGGTTCTCCCGATGTTGCT
GGCGAATACATATATTTGACGCCCAGGTCAAGCGATGCCATTACTGTTCGCTTCGCGATTGAGGGCACCTCGTCG
GTTTGTCGCCATGGCAGCCTCTGGGTCAATATTCCTGAGCGGGGTGTCGAGTTTCGTCGCCATAGCTTCAGGCAG
TTTGAGCTGAATCCAGATTTCAACCGCACAATCGAAGTCTCAGTACCCATTTACCACCCGGGCGCTTTTGCTTTT
TACCTTAGCTACGCTGAGCTGCCTCGTCTGGAAGCGCGCCTTGCGGCAGAGCCGGCGGAACCCGACGAGAAGCAC
CTAACCAAGACTCCTCTCTACTATATTGATGTCGCTCCCAGGTTGCAGCTCGACGGCCGTCCGCTGCCCTTGCCT
GCTCTCTCCATTTTTTCCGTCATTGGGAAACTCATGGGAAAGTACCCCATCGATTGGGAGAGGCACCTGCGCAGC
ATTGCCGATCGGGGCTACAACATGATTCATTTCACGCCCCTTCAGCAACGAGGCGATTCCAACTCGCCCTTTAGC
TTGTACGACCAGCTGGCTTGGGACCCTCAGTGCTTTCCTCGTGGCGAGGCCGATGTGCAGGACTTGGTTGACAGC
ATGGAGCAAAAGCACTCTCTTCTTAGTCTCACTGATGTTGTCTTGAACCACACGGCGAATAACTCAAAGTGGCTC
CAGCAGCATCCAGAAGCCGGATACAACCTTTCGACTGCCCCATGGCTGGAATCTGCCTACGAGCTTGACACCAAA
CTCCTTGAGCTTAGCGACAAGTTGCAGTCAATGGGGCTTCCAGTTGACATCAAGTCCACGGATGATTTACTACGC
ATCATGGATGCCGTCAAGGACGTTATTGGCAAGATTCGCCTATGGGAATACTATGCCCTTGACCTTGATGGCAAC
GTCGACTCTGCTGTGGACTATTGGGTTCAGAATAAGACTTCCAACGTTGACGTGTCAGAGACAACGGTCAACAAG
CTTAAGAATGGATCCGCCGAGGACGAGGCTGCTTTTGTAAAAGAGTTTGGCTTGCATGGTCTGGACCGTCTCGGA
GAGCGATTTAGGCGAAGAATCGATCCAGCCGTGGCAGCTACCCTCTTGTCCTTTTCTCTCGGTCGTTTTGATAGC
CGAGATGGCAGCGCACCCGACAAGGCTGCAGCAAAGGCGCGGATCCTGGAAGTGGTGAATGCCCTCAATGTCGAC
CTTTACAAGGAATATGATGGTGATATCAAGGAGATTTTGGATCAGCTTTACAATCGCATCAAGTACATGCGTCTG
GATGACCACGGCCCCAAACTCGGTCCAATCAATGAAAAGAATCCTCTAATAGAGACATACTTTACCCGACTGCCC
TCAAACAAGACGACGTCTTGTCATAAACCAGGGGACTTGGCGCTGGTCAATAATGGCTGGGTATGGGCGGGCAAC
GCGCTCGTCGACAATGCGGGCCCCGACTCTAGAGTTTACTTGAGGCGCGAAGTCATTGTCTGGGGAGACTGTGTC
AAGCTACGATATGGCTCGGGTCCCGAGGACAGCCCCTGGTTGTGGAAGCACATGACTGCCTATGCGCGCATGCTG
GCCAAGTTGTTTAATGGCTTTCGCATTGACAATTGTCATTCCACTCCTATCCACGTGGCTGAATATATACTTGAC
GAAGCACGCCGTGTACGCCCCGACTTGTACATTGTGGCTGAGCTTTTTACTGGATCAGAAGAAATGGACTATGTC
TTTGTCAAGCGACTTGGAATTAGCTCGCTGGTGCGCGAAGCGATGCAGGCTTGGAGTACTGCAGAACTCAGCAGA
TTGGTTCACAAGCACGGCGGGCGCCCCATTGGCAGCTTCGAGGTGGACGAGGTTACACGCTTGGACGCAAGCTCT
TCGTCGACCAGTCTGTCGAGTTTGAGCCAACGCACATGCAATGGCTCACTCTGCAGGGAGATTGTCAGAAGAATC
AAGCCTACTCCTGTCCACGCACTCTTTATGGACTGCACTCATGACAATGAGATGCCTGCACAGAAGCGAGACGCA
AGAGATACTCTGCCTAATGCAGCGCTTGTCAATATGTGTTCGAGTGCCACGGGCAGCGTCGTGGGCTATGACGAG
ATTTATCCTCGGCTGGTTGACTTGGTTGGCGAGAAGCGGTTGTATCTACCGTGGACGAGTTCTAGTCCACAAAAG
CCTGGCAGCTACAGCAACAAGGGCATTGGTGGAATCAAGAAGCTCCTTAACCAGATTCACACACTAATGGGCAAG
GATGGTTATGATGAAACACACATTCATCATGAAGATGAGTATATCACGGTTCACAGGGTGCACCCCAAATCCCGC
AAGGGCTACTTCCTCATTGCACACACGGCATTTCCGGGATATGGCAACGGCAACGGAAACTTTAGCCCTGTGCGC
CTGACTGGTACACGGGTAGACCACTTGGGAAGTTGGACGCTCGAGGTAGACTCGAGTGCAGAGGCTGTCAAGCGG
ACCCTGGCAGACCCAAAATATCTCAAGGGTCTTCCAAGCCGCGTCTTGGACGTGGAAGGCGTCGACGTTGAAATA
CAGAGCGACACCACAGTTATTAGTGTCCATGAGAACTTCCCACCTGGGAGCATTGCTCTTTTTGAGACTTGGATA
CCGACGGCAGAGCACTCTGTTGGTTTGGATACCTTTGTCACTTCGGGCGCAAAGGCGGCGTGGGACCAGCTCGAC
TTGATTGACCTCAACTTTGTCATGTATCGCTGCGAGGCCGAGGAGCTGGACTGGAGCAGGGGACGAGATGGCACG
TATCATGTTCCCAACCATGGCAAGCTTGTGTATGCTGGCCTACAAGGGTGGTGGAGTGTTCTCGGCAAGGTGATT
CGGGAAAACAATTTGGGCCATGCCCTGTGCCAGAACCTTCGAGACGGCAAGTGGGCTCTGGACTATATTGTTGGG
CGTCTTGAGCGCATGAGCAAGACTGCGGGTAACGAGCGTCTATCCCAACCGGCAAAATGGCTCAAGGAGCGCTTT
GATGCCATTCGCACTATTCCCAGCTTTCTTCTACCAAGATACTTTGGCTTAGTGTTGCGCACTGCCTACCTTGCC
AGCTGGGACCGGGCCATGGAGTTGATGAACAGCAACGTGTCGGGAGGGCAGTGGTTCTTGCAGAGCCTGGCCATG
GTTAGCGTACAACAAACCGGATACGTCAAGTGCTGGGGGCGCGACGTCTTCATCTCCATTCGCGGCTTATTTCTC
GGCACTGGGCGTGGCGATGCGCCGCGATACAACTCGCGAGACTCCATCTGGTTCTTTTTGCAGGCCATTCAAGAC
TATGTCTACTTTGCCCCCGAGGGAGTGGCTTTGCTGCAAGAAAGGGTGAAGCGACGGTTCTTGCCATACGATGAC
ACGTGGTTCCCGACGAGCGATGCGAGGGCTTACTCTGAGGAAAGCTCGATTGAGGAGGTGATTCAGGAAGCCCTT
CAACGGCATGCCTCGGGCATCAAGTTTCGCGAGGCAAATGCTGGGCCGCAGATTGACTCTCAGATGAAGGACCAA
GGTTTCAGCCAGGAAATCAAGGTGGACTGGCAAACGGGCATCATTTTTGGCGGCAACCAGTTCAACTGCGGCACG
TGGATGGACAAGATGGGAGAGAGCTCGCGGGCCGGCTCCAAGGGGATCCCCGGGACTCCGCGCGACGGGGCGGCC
ATTGAGATTACCGGGCTGCTCTACAGCACGCTGGCATGGCTGGCGTCGATGCACAAGGAGCAAAAGTATGCCTAC
TCTGGAGTCGAGGCTGCCGACGGCACGTCTGTGACATTTGCGAGCTGGGCGGACCGCATCAAGGCCAATTTTGAG
CGATGCTACTATGTTCCGCAGACGCCGCAAGACGACGGCGCCTACGACGTGAATGCCAAAGTGATCAACCGGCGC
GGCATCTACAAGGACCTGTACCGCTCGGGCAAGGAGTACGAAGACTACCAGCTGCGCCCCAACTTTGCCATTGCC
ATGACGGTGGCGCCTCGGCTCTTTGACGCGCGGCACGCCATGGCGGCGCTGTGCACAGCGGATGCAGTGCTGCGC
GGGCCGACGGGCATGGCGACGCTGGACCCGGCCGACTTGAACTACCGGCCCTATTACCGCAACAGCGACGACGGC
GACGACTTTGCAACGGCACGCGGGCGCAACTACCACCAGGGGCCCGAGTGGCTATGGCCCATGGGCTTTTTCTTG
CGCGCCCTCCTAAAGTTTGACTTGGCGAGGCGGACGGCGGCGCAGGGGCGCATCGAGGCCTTTCAGCAGGTGACG
CGCCGGCTGGGCGGCTGTAAGCGCATGATGAGGGAGAGTGCCTGGGCTGGACTGACGGAGCTGACGCAAAAGAAG
GGCGAATACTGTCCCGACTCTAGCCCGACACAGGCGTGGTCGGCGGGCTGCCTCATTGACTTGTACATGGATGCC
CTGCAAGAGCAGCAGCACGATTAG
Gene >OphauB2|6793
ATGAGCCCGCGAATAATGACGTCCACCGAGGTTTATTTGCTGCCGCTCAACGACAATGGTTCTCCCGATGTTGCT
GGCGAATACATATATTTGACGCCCAGGTCAAGCGATGCCATTACTGTTCGCTTCGCGATTGAGGGCACCTCGTCG
GTTTGTCGCCATGGCAGCCTCTGGGTCAATATTCCTGAGCGGGGTGTCGAGTTTCGTCGCCATAGCTTCAGGCAG
TTTGAGTGCGTCGCCGCCCTGTCATGATTGGCTTTGCTCAATCGCGCTCACATAGCTTGCGCCCAGGCTGAATCC
AGATTTCAACCGCACAATCGAAGTCTCAGTACCCATTTACCACCCGGGCGCTTTTGCTTTTTACCTTAGCTACGC
TGAGCTGCCTCGTCTGGAAGCGCGCCTTGCGGCAGAGCCGGCGGAACCCGACGAGAAGCACCTAACCAAGACTCC
TCTCTACTATATTGATGTCGCTCCCAGGTTGCAGCTCGACGGCCGTCCGCTGCCCTTGCCTGCTCTCTCCATTTT
TTCCGTCATTGGGAAACTCATGGGAAAGTACCCCATCGATTGGGAGAGGCACCTGCGCAGCATTGCCGATCGGGG
CTACAACATGATTCATTTCACGCCCCTTCAGCAACGAGGCGATTCCAACTCGCCCTTTAGCTTGTACGACCAGCT
GGCTTGGGACCCTCAGTGCTTTCCTCGTGGCGAGGCCGATGTGCAGGACTTGGTTGACAGCATGGAGCAAAAGCA
CTCTCTTCTTAGTCTCACTGATGTTGTCTTGAACCACACGGCGAATAACTCAAAGTGGCTCCAGCAGCATCCAGA
AGCCGGATACAACCTTTCGACTGCCCCATGGCTGGAATCTGCCTACGAGCTTGACACCAAACTCCTTGAGCTTAG
CGACAAGTTGCAGTCAATGGGGCTTCCAGTTGACATCAAGTCCACGGATGATTTACTACGCATCATGGATGCCGT
CAAGGACGTTATTGGCAAGATTCGCCTATGGGAATACTATGCCCTTGACCTTGATGGCAACGTCGACTCTGCTGT
GGACTATTGGGTTCAGAATAAGACTTCCAACGTTGACGTGTCAGAGACAACGGTCAACAAGCTTAAGAATGGATC
CGCCGAGGACGAGGCTGCTTTTGTAAAAGAGTTTGGCTTGCATGGTCTGGACCGTCTCGGAGAGCGATTTAGGCG
AAGAATCGATCCAGCCGTGGCAGCTACCCTCTTGTCCTTTTCTCTCGGTCGTTTTGATAGCCGAGATGGCAGCGC
ACCCGACAAGGCTGCAGCAAAGGCGCGGATCCTGGAAGTGGTGAATGCCCTCAATGTCGACCTTTACAAGGAATA
TGATGGTGATATCAAGGAGATTTTGGATCAGCTTTACAATCGCATCAAGTACATGCGTCTGGATGACCACGGCCC
CAAACTCGGTCCAATCAATGAAAAGAATCCTCTAATAGAGACATACTTTACCCGACTGCCCTCAAACAAGACGAC
GTCTTGTCATAAACCAGGGGACTTGGCGCTGGTCAATAATGGCTGGGTATGGGCGGGCAACGCGCTCGTCGACAA
TGCGGGCCCCGACTCTAGAGTTTACTTGAGGCGCGAAGTCATTGTCTGGGGAGACTGTGTCAAGCTACGATATGG
CTCGGGTCCCGAGGACAGCCCCTGGTTGTGGAAGCACATGACTGCCTATGCGCGCATGCTGGCCAAGTTGTTTAA
TGGCTTTCGCATTGACAATTGTCATTCCACTCCTATCCACGTGGCTGAATATATACTTGACGAAGCACGCCGTGT
ACGCCCCGACTTGTACATTGTGGCTGAGCTTTTTACTGGATCAGAAGAAATGGACTATGTCTTTGTCAAGCGACT
TGGAATTAGCTCGCTGGTGCGCGAAGCGATGCAGGCTTGGAGTACTGCAGAACTCAGCAGATTGGTTCACAAGCA
CGGCGGGCGCCCCATTGGCAGCTTCGAGGTGGACGAGGTTACACGCTTGGACGCAAGCTCTTCGTCGACCAGTCT
GTCGAGTTTGAGCCAACGCACATGCAATGGCTCACTCTGCAGGGAGATTGTCAGAAGAATCAAGCCTACTCCTGT
CCACGCACTCTTTATGGACTGCACTCATGACAATGAGATGCCTGCACAGAAGCGAGACGCAAGAGATACTCTGCC
TAATGCAGCGCTTGTCAATATGTGTTCGAGTGCCACGGGCAGCGTCGTGGGCTATGACGAGATTTATCCTCGGCT
GGTTGACTTGGTTGGCGAGAAGCGGTTGTATCTACCGTGGACGAGTTCTAGTCCACAAAAGCCTGGCAGCTACAG
CAACAAGGGCATTGGTGGAATCAAGAAGCTCCTTAACCAGATTCACACACTAATGGGCAAGGATGGTTATGATGA
AACACACATTCATCATGAAGATGAGTATATCACGGTTCACAGGGTGCACCCCAAATCCCGCAAGGGCTACTTCCT
CATTGCACACACGGCATTTCCGGGATATGGCAACGGCAACGGAAACTTTAGCCCTGTGCGCCTGACTGGTACACG
GGTAGACCACTTGGGAAGTTGGACGCTCGAGGTAGACTCGAGTGCAGAGGCTGTCAAGCGGACCCTGGCAGACCC
AAAATATCTCAAGGGTCTTCCAAGCCGCGTCTTGGACGTGGAAGGCGTCGACGTTGAAATACAGAGCGACACCAC
AGTTATTAGTGTCCATGAGAACTTCCCACCTGGGAGCATTGCTCTTTTTGAGACTTGGATACCGACGGCAGAGCA
CTCTGTTGGTTTGGATACCTTTGTCACTTCGGGCGCAAAGGCGGCGTGGGACCAGCTCGACTTGATTGACCTCAA
CTTTGTCATGTATCGCTGCGAGGCCGAGGAGCTGGACTGGAGCAGGGGACGAGATGGCACGTATCATGTTCCCAA
CCATGGCAAGCTTGTGTATGCTGGCCTACAAGGGTGGTGGAGTGTTCTCGGCAAGGTGATTCGGGAAAACAATTT
GGGCCATGCCCTGTGCCAGAACCTTCGAGACGGCAAGTGGGCTCTGGACTATATTGTTGGGCGTCTTGAGCGCAT
GAGCAAGACTGCGGGTAACGAGCGTCTATCCCAACCGGCAAAATGGCTCAAGGAGCGCTTTGATGCCATTCGCAC
TATTCCCAGCTTTCTTCTACCAAGATACTTTGGCTTAGTGTTGCGCACTGCCTACCTTGCCAGCTGGGACCGGGC
CATGGAGTTGATGAACAGCAACGTGTCGGGAGGGCAGTGGTTCTTGCAGAGCCTGGCCATGGTTAGCGTACAACA
AACCGGATACGTCAAGTCGGCTTCCTTGTGGCCCCAGAAAAGTGTGCCCTGCATAGCTGCTGGCTTGCCACACTT
TGCTGTTGAGTGGGCCAGGTGCTGGGGGCGCGACGTCTTCATCTCCATTCGCGGCTTATTTCTCGGCACTGGGCG
GTTTGCAGAGGCCAAGAAGCATATACTAGCTTTTGCGAGCGTGTTGAATCATGGAATGATACCCAATCTACTCAG
CAGTGGCGATGCGCCGCGATACAACTCGCGAGACTCCATCTGGTTCTTTTTGCAGGCCATTCAAGACTATGTCTA
CTTTGCCCCCGAGGGAGTGGCTTTGCTGCAAGAAAGGGTGAAGCGACGGTTCTTGCCATACGATGACACGTGGTT
CCCGACGAGCGATGCGAGGGCTTACTCTGAGGAAAGCTCGATTGAGGAGGTGATTCAGGAAGCCCTTCAACGGCA
TGCCTCGGGCATCAAGTTTCGCGAGGCAAATGCTGGGCCGCAGATTGACTCTCAGATGAAGGACCAAGGTTTCAG
CCAGGAAATCAAGGTGGACTGGCAAACGGGCATCATTTTTGGCGGCAACCAGTTCAACTGCGGCACGTGGATGGA
CAAGATGGGAGAGAGCTCGCGGGCCGGCTCCAAGGGGATCCCCGGGACTCCGCGCGACGGGGCGGCCATTGAGAT
TACCGGGCTGCTCTACAGCACGCTGGCATGGCTGGCGTCGATGCACAAGGAGCAAAAGTATGCCTACTCTGGAGT
CGAGGCTGCCGACGGCACGTCTGTGACATTTGCGAGCTGGGCGGACCGCATCAAGGCCAATTTTGAGCGATGCTA
CTATGTTCCGCAGACGCCGCAAGACGACGGCGCCTACGACGTGAATGCCAAAGTGATCAACCGGCGCGGCATCTA
CAAGGACCTGTACCGCTCGGGCAAGGAGTACGAAGACTACCAGCTGCGCCCCAACTTTGCCATTGCCATGACGGT
GGCGCCTCGGCTCTTTGACGCGCGGCACGCCATGGCGGCGCTGTGCACAGCGGATGCAGTGCTGCGCGGGCCGAC
GGGCATGGCGACGCTGGACCCGGCCGACTTGAACTACCGGCCCTATTACCGCAACAGCGACGACGGCGACGACTT
TGCAACGGCACGCGGGCGCAACTACCACCAGGGGCCCGAGTGGCTATGGCCCATGGGCTTTTTCTTGCGCGCCCT
CCTAAAGTTTGACTTGGCGAGGCGGACGGCGGCGCAGGGGCGCATCGAGGCCTTTCAGCAGGTGACGCGCCGGCT
GGGCGGCTGTAAGCGCATGATGAGGGAGAGTGCCTGGGCTGGACTGACGGAGCTGACGCAAAAGAAGGGCGAATA
CTGTCCCGACTCTGTGAGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCAAGCCTGCTGCATTCCTTGT
ACTAATGCTTGACAGAGCCCGACACAGGCGTGGTCGGCGGGCTGCCTCATTGACTTGTACATGGATGCCCTGCAA
GAGCAGCAGCACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail