Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6792
Gene name
LocationContig_65:102943..105795
Strand-
Gene length (bp)2852
Transcript length (bp)2610
Coding sequence length (bp)2610
Protein length (aa) 870

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 9.0E-83 407 679
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 7.2E-45 33 183
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.4E-34 206 395
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 1.1E-31 766 861

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 32 717 3.0E-159
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 46 867 1.0E-145
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 28 759 2.0E-137
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 59 747 6.0E-38
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 40 737 3.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 32 717 3.0E-159
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 46 867 1.0E-145
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 28 759 2.0E-137
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 59 747 6.0E-38
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 40 737 3.0E-37
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 59 737 1.0E-36
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 59 816 4.0E-36
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 48 700 1.0E-35
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 40 749 2.0E-35
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 40 702 8.0E-34
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 135 677 2.0E-32
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 135 745 3.0E-32
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 418 733 7.0E-32
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 83 697 3.0E-31
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 42 712 3.0E-30
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 59 684 2.0E-29
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 54 702 2.0E-25
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 36 760 7.0E-25
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 41 711 8.0E-23
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 48 717 2.0E-18
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 765 861 3.0E-09
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 388 681 7.0E-08
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 350 681 4.0E-07
sp|Q8CBX0|CSC1_MOUSE Calcium permeable stress-gated cation channel 1 OS=Mus musculus GN=Tmem63c PE=1 SV=1 82 644 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 110 132 22
3 162 181 19
4 411 433 22
5 453 475 22
6 502 524 22
7 551 573 22
8 594 616 22
9 621 643 22
10 664 682 18
11 687 709 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6792
MGAFISWIKKNLPSGDQAGEAQNSKPQSVWGMIDTLVPVLVVSVIYLLIFLFFRRSQRRFYAPRTYLGSLRRSQR
SPDLPNGWFDWIGKFWRIPDSEALRSQGLDSYLFLRYLRVAMIISFVSLCITWPILFPVNATGKGGQSQLEILSY
SNVSVDKSPNRFFAHVFVGWVVYGFVMYMILRECIFYINLRQAYLLSPRSSRLISSRTVLFTSVPNDYLNEGRIR
QMFNDSVRHVWFAGDAEKVDELVEERDKVAMKLENAEVGLIKMVNKARTKAAKKSTADTEGVLDSESGNVAARYV
PDKKRPSHRLGPLGLVGKKVDTIEWSRSELQRLVPETDRVQAEWAAGNYKKSNAVFVEFFTQADAQAAYQTLTHH
QALRMCPKYIGVKPAEVVWSSLSISWWQLVLRRYAVLAFITALIIFWAIPVAIVGLIAQVSTLKTLPGLTWLDKI
PKPILGVVSGLLPSVALSILMSLVPVIMRFCAKKSGEPTLSRVELFTQNAYFVFQIIQVFLVQTVFNAASTALVQ
IVQNPGSVFEILGKTLPTTSNFYISYFIVQGLTISVGVLTQVVGMFIFRILYKFLAGTPRAMYTKWTTLSAILWG
SLLPVYTNIICISLVFSVIAPIILFWSTLGLALFYFAYRYNVFFVSESSVDTQGLIYPRALKQLFTGIYLAEICM
VGLFAVVKAPGPAVLMAAFLVFTILFQITMFKNLDPLLYALPRSVQAQEHLIRSGLSEPDVSHETSTEKGAALKN
VSGSGAKGKGNIFMRFIKPWMYNDYEAMRRLVPQDEGMDLQSQYTEKVEASAYLPPSVTSEVPTLWIPRDAAGVS
QQEVAASSKVIPITDEGATIDEKNNIIWDTEGARPPVWEEKVVY*
Coding >OphauB2|6792
ATGGGTGCTTTTATCAGTTGGATCAAGAAGAACCTGCCCAGCGGTGACCAGGCAGGCGAGGCTCAGAATTCGAAG
CCTCAGTCAGTATGGGGCATGATTGATACGCTGGTCCCGGTGCTGGTAGTGTCGGTCATCTACCTGCTCATCTTT
TTATTCTTCAGGAGATCGCAACGTCGCTTCTACGCCCCGAGGACATATCTGGGATCCTTGCGCCGCAGTCAACGA
AGCCCGGACCTGCCCAATGGTTGGTTTGACTGGATTGGTAAATTCTGGAGGATTCCCGACTCGGAGGCCCTGCGC
AGCCAGGGTCTCGATTCCTATCTCTTCCTCCGCTACCTGCGCGTTGCCATGATTATATCCTTTGTCAGTCTGTGC
ATCACGTGGCCCATTCTCTTCCCCGTCAACGCCACGGGCAAGGGCGGACAGTCGCAGCTTGAGATTTTGTCGTAT
AGCAATGTGTCGGTGGACAAGTCGCCCAACCGCTTCTTTGCCCACGTCTTTGTCGGCTGGGTCGTCTATGGCTTC
GTCATGTACATGATTTTGCGCGAGTGCATCTTCTACATCAACCTGCGCCAGGCCTACTTGCTCTCGCCCCGCTCG
TCGCGTCTTATTTCGTCGCGCACCGTGCTCTTCACCTCGGTCCCCAATGACTATCTCAATGAGGGCCGCATCCGC
CAAATGTTTAATGACTCGGTCCGCCATGTCTGGTTTGCCGGCGATGCGGAAAAGGTGGACGAGCTGGTTGAGGAG
CGCGACAAGGTGGCGATGAAGCTGGAAAACGCAGAGGTGGGCCTCATCAAAATGGTCAACAAGGCGCGCACAAAG
GCGGCCAAGAAGTCGACGGCCGATACCGAGGGCGTCCTCGACTCCGAGTCGGGCAATGTTGCTGCTCGCTATGTG
CCCGACAAGAAGCGGCCCTCGCACCGTCTGGGGCCTCTGGGCCTGGTTGGCAAAAAGGTTGATACCATTGAGTGG
TCGCGCTCCGAGCTGCAGCGCCTCGTGCCCGAGACGGACCGTGTCCAGGCTGAATGGGCAGCCGGCAACTACAAG
AAGAGCAATGCCGTCTTTGTCGAGTTCTTCACCCAGGCCGATGCCCAGGCTGCCTACCAGACCCTGACGCACCAC
CAGGCTCTGCGCATGTGCCCCAAGTATATTGGCGTCAAGCCGGCCGAGGTGGTTTGGAGCAGCCTTTCGATTTCT
TGGTGGCAGCTGGTTCTTCGCCGCTATGCCGTCTTGGCCTTTATCACGGCGCTGATTATCTTTTGGGCCATTCCT
GTTGCCATTGTCGGTCTCATTGCCCAAGTCAGCACGCTCAAGACATTGCCCGGCCTGACTTGGCTCGACAAGATT
CCCAAGCCCATTCTCGGTGTCGTTTCTGGCTTGCTTCCCTCTGTTGCTCTGTCCATACTCATGTCGTTGGTGCCC
GTCATCATGCGCTTTTGCGCCAAGAAGTCTGGCGAGCCCACCTTGTCGCGAGTCGAGCTCTTTACGCAAAACGCC
TACTTTGTCTTTCAAATCATTCAAGTCTTCCTTGTCCAGACCGTCTTCAACGCTGCCTCGACTGCCCTGGTGCAA
ATTGTGCAGAATCCGGGAAGCGTGTTTGAAATTCTGGGCAAGACGCTGCCGACAACGTCCAACTTTTACATTTCC
TACTTTATCGTGCAGGGCTTGACCATTTCAGTCGGCGTCTTGACCCAGGTTGTTGGCATGTTCATCTTTCGAATT
CTCTACAAGTTTCTTGCTGGCACGCCGAGAGCCATGTACACCAAGTGGACCACGCTCAGCGCCATTCTCTGGGGC
AGTCTTTTGCCCGTTTACACCAACATTATCTGCATTAGTCTCGTCTTTTCCGTTATTGCCCCCATCATTTTGTTT
TGGTCAACGCTTGGCCTGGCCCTCTTTTACTTTGCCTACCGCTACAACGTCTTTTTCGTTTCCGAGTCGTCTGTT
GACACGCAGGGCCTCATTTACCCCCGCGCGCTCAAGCAGCTCTTTACCGGTATCTATTTGGCCGAGATTTGCATG
GTTGGCCTCTTCGCCGTGGTCAAGGCTCCCGGACCGGCGGTGCTCATGGCTGCCTTTCTCGTCTTTACCATTCTC
TTCCAAATCACCATGTTTAAGAATCTGGATCCCCTGCTCTATGCCTTGCCGCGCAGCGTGCAGGCGCAAGAGCAC
TTGATTCGATCTGGCCTTAGCGAGCCCGATGTTTCCCACGAGACGAGCACGGAAAAGGGCGCGGCTCTCAAGAAT
GTCAGCGGCAGCGGTGCCAAGGGCAAGGGCAACATTTTTATGCGCTTCATCAAGCCTTGGATGTACAATGACTAT
GAGGCGATGCGCCGGCTCGTTCCCCAGGACGAAGGCATGGACCTGCAGAGCCAGTACACGGAAAAGGTGGAGGCG
TCGGCCTACCTGCCGCCGTCTGTGACGAGCGAAGTGCCGACTCTGTGGATTCCTCGCGACGCGGCTGGCGTGTCG
CAGCAAGAGGTGGCGGCATCGAGCAAGGTGATTCCGATTACGGACGAGGGCGCCACGATTGACGAAAAGAATAAT
ATTATTTGGGACACTGAAGGTGCACGGCCGCCCGTGTGGGAGGAAAAGGTTGTTTACTAG
Transcript >OphauB2|6792
ATGGGTGCTTTTATCAGTTGGATCAAGAAGAACCTGCCCAGCGGTGACCAGGCAGGCGAGGCTCAGAATTCGAAG
CCTCAGTCAGTATGGGGCATGATTGATACGCTGGTCCCGGTGCTGGTAGTGTCGGTCATCTACCTGCTCATCTTT
TTATTCTTCAGGAGATCGCAACGTCGCTTCTACGCCCCGAGGACATATCTGGGATCCTTGCGCCGCAGTCAACGA
AGCCCGGACCTGCCCAATGGTTGGTTTGACTGGATTGGTAAATTCTGGAGGATTCCCGACTCGGAGGCCCTGCGC
AGCCAGGGTCTCGATTCCTATCTCTTCCTCCGCTACCTGCGCGTTGCCATGATTATATCCTTTGTCAGTCTGTGC
ATCACGTGGCCCATTCTCTTCCCCGTCAACGCCACGGGCAAGGGCGGACAGTCGCAGCTTGAGATTTTGTCGTAT
AGCAATGTGTCGGTGGACAAGTCGCCCAACCGCTTCTTTGCCCACGTCTTTGTCGGCTGGGTCGTCTATGGCTTC
GTCATGTACATGATTTTGCGCGAGTGCATCTTCTACATCAACCTGCGCCAGGCCTACTTGCTCTCGCCCCGCTCG
TCGCGTCTTATTTCGTCGCGCACCGTGCTCTTCACCTCGGTCCCCAATGACTATCTCAATGAGGGCCGCATCCGC
CAAATGTTTAATGACTCGGTCCGCCATGTCTGGTTTGCCGGCGATGCGGAAAAGGTGGACGAGCTGGTTGAGGAG
CGCGACAAGGTGGCGATGAAGCTGGAAAACGCAGAGGTGGGCCTCATCAAAATGGTCAACAAGGCGCGCACAAAG
GCGGCCAAGAAGTCGACGGCCGATACCGAGGGCGTCCTCGACTCCGAGTCGGGCAATGTTGCTGCTCGCTATGTG
CCCGACAAGAAGCGGCCCTCGCACCGTCTGGGGCCTCTGGGCCTGGTTGGCAAAAAGGTTGATACCATTGAGTGG
TCGCGCTCCGAGCTGCAGCGCCTCGTGCCCGAGACGGACCGTGTCCAGGCTGAATGGGCAGCCGGCAACTACAAG
AAGAGCAATGCCGTCTTTGTCGAGTTCTTCACCCAGGCCGATGCCCAGGCTGCCTACCAGACCCTGACGCACCAC
CAGGCTCTGCGCATGTGCCCCAAGTATATTGGCGTCAAGCCGGCCGAGGTGGTTTGGAGCAGCCTTTCGATTTCT
TGGTGGCAGCTGGTTCTTCGCCGCTATGCCGTCTTGGCCTTTATCACGGCGCTGATTATCTTTTGGGCCATTCCT
GTTGCCATTGTCGGTCTCATTGCCCAAGTCAGCACGCTCAAGACATTGCCCGGCCTGACTTGGCTCGACAAGATT
CCCAAGCCCATTCTCGGTGTCGTTTCTGGCTTGCTTCCCTCTGTTGCTCTGTCCATACTCATGTCGTTGGTGCCC
GTCATCATGCGCTTTTGCGCCAAGAAGTCTGGCGAGCCCACCTTGTCGCGAGTCGAGCTCTTTACGCAAAACGCC
TACTTTGTCTTTCAAATCATTCAAGTCTTCCTTGTCCAGACCGTCTTCAACGCTGCCTCGACTGCCCTGGTGCAA
ATTGTGCAGAATCCGGGAAGCGTGTTTGAAATTCTGGGCAAGACGCTGCCGACAACGTCCAACTTTTACATTTCC
TACTTTATCGTGCAGGGCTTGACCATTTCAGTCGGCGTCTTGACCCAGGTTGTTGGCATGTTCATCTTTCGAATT
CTCTACAAGTTTCTTGCTGGCACGCCGAGAGCCATGTACACCAAGTGGACCACGCTCAGCGCCATTCTCTGGGGC
AGTCTTTTGCCCGTTTACACCAACATTATCTGCATTAGTCTCGTCTTTTCCGTTATTGCCCCCATCATTTTGTTT
TGGTCAACGCTTGGCCTGGCCCTCTTTTACTTTGCCTACCGCTACAACGTCTTTTTCGTTTCCGAGTCGTCTGTT
GACACGCAGGGCCTCATTTACCCCCGCGCGCTCAAGCAGCTCTTTACCGGTATCTATTTGGCCGAGATTTGCATG
GTTGGCCTCTTCGCCGTGGTCAAGGCTCCCGGACCGGCGGTGCTCATGGCTGCCTTTCTCGTCTTTACCATTCTC
TTCCAAATCACCATGTTTAAGAATCTGGATCCCCTGCTCTATGCCTTGCCGCGCAGCGTGCAGGCGCAAGAGCAC
TTGATTCGATCTGGCCTTAGCGAGCCCGATGTTTCCCACGAGACGAGCACGGAAAAGGGCGCGGCTCTCAAGAAT
GTCAGCGGCAGCGGTGCCAAGGGCAAGGGCAACATTTTTATGCGCTTCATCAAGCCTTGGATGTACAATGACTAT
GAGGCGATGCGCCGGCTCGTTCCCCAGGACGAAGGCATGGACCTGCAGAGCCAGTACACGGAAAAGGTGGAGGCG
TCGGCCTACCTGCCGCCGTCTGTGACGAGCGAAGTGCCGACTCTGTGGATTCCTCGCGACGCGGCTGGCGTGTCG
CAGCAAGAGGTGGCGGCATCGAGCAAGGTGATTCCGATTACGGACGAGGGCGCCACGATTGACGAAAAGAATAAT
ATTATTTGGGACACTGAAGGTGCACGGCCGCCCGTGTGGGAGGAAAAGGTTGTTTACTAG
Gene >OphauB2|6792
ATGGGTGCTTTTATCAGTTGGATCAAGAAGAACCTGCCCAGCGGTGACCAGGCAGGCGAGGCTCAGAATTCGAAG
CCTCAGTCAGTATGGGGTCAGTTGCGAATAGTGTTTCCTTGGTGGCCGCCTCAAGACCAGCGTCTAACCAGTGCA
CAGGCATGATTGATACGCTGGTCCCGGTGCTGGTAGTGTCGGTCATCTACCTGCTCATCTTTTTATTCTTCAGGA
GATCGCAACGTCGCTTCTACGCCCCGAGGACATATCTGGGATCCTTGCGCCGCAGGTAATTTGCCAGGCTAGAAT
TCTTCAAACAGCCATGGGAGCGCTGACCCTTGTTGCCAGTCAACGAAGCCCGGACCTGCCCAATGGTTGGTTTGA
CTGGATTGGTAAATTCTGGAGGATTCCCGACTCGGAGGCCCTGCGCAGCCAGGGTCTCGATTCCTATCTCTTCCT
CCGCTACCTGCGCGTTGCCATGATTATATCCTTTGTCAGTCTGTGCATCACGTGGCCCATTCTCTTCCCCGTCAA
CGCCACGGGCAAGGGCGGACAGTCGCAGCTTGAGATTTTGTCGTATAGCAATGTGTCGGTGGACAAGTCGCCCAA
CCGCTTCTTTGCCCACGTCTTTGTCGGCTGGGTCGTCTATGGCTTCGTCATGTACATGATTTTGCGCGAGTGCAT
CTTCTACATCAACCTGCGCCAGGCCTACTTGCTCTCGCCCCGCTCGTCGCGTCTTATTTCGTCGCGCACCGTGCT
CTTCACCTCGGTCCCCAATGACTATCTCAATGAGGGCCGCATCCGCCAAATGTTTAATGACTCGGTCCGCCATGT
CTGGTTTGCCGGCGATGCGGAAAAGGTGGACGAGCTGGTTGAGGAGCGCGACAAGGTGGCGATGAAGCTGGAAAA
CGCAGAGGTGGGCCTCATCAAAATGGTCAACAAGGCGCGCACAAAGGCGGCCAAGAAGTCGACGGCCGATACCGA
GGGCGTCCTCGACTCCGAGTCGGGCAATGTTGCTGCTCGCTATGTGCCCGACAAGAAGCGGCCCTCGCACCGTCT
GGGGCCTCTGGGCCTGGTTGGCAAAAAGGTTGATACCATTGAGTGGTCGCGCTCCGAGCTGCAGCGCCTCGTGCC
CGAGACGGACCGTGTCCAGGCTGAATGGGCAGCCGGCAACTACAAGAAGAGCAATGCCGTCTTTGTCGAGTTCTT
CACCCAGGCCGATGCCCAGGCTGCCTACCAGACCCTGACGCACCACCAGGCTCTGCGCATGTGCCCCAAGTATAT
TGGCGTCAAGCCGGCCGAGGTGGTTTGGAGCAGCCTTTCGATTTCTTGGTGGCAGCTGGTTCTTCGCCGCTATGC
CGTCTTGGCCTTTATCACGGCGCTGATTATCTTTTGGGCCATTCCTGTTGCCATTGTCGGTCTCATTGCCCAAGT
CAGCACGCTCAAGACATTGCCCGGCCTGACTTGGCTCGACAAGATTCCCAAGGTGTGTTTTTTTACCTCTGTGAA
GCCCCGTGTCCCGTGTCTGTTCCTTGTGGGCTAACCGCAGCTGCAGCCCATTCTCGGTGTCGTTTCTGGCTTGCT
TCCCTCTGTTGCTCTGTCCATACTCATGTCGTTGGTGCCCGTCATCATGCGCTTTTGCGCCAAGAAGTCTGGCGA
GCCCACCTTGTCGCGAGTCGAGCTCTTTACGCAAAACGCCTACTTTGTCTTTCAAATCATTCAAGTCTTCCTTGT
CCAGACCGTCTTCAACGCTGCCTCGACTGCCCTGGTGCAAATTGTGCAGAATCCGGGAAGCGTGTTTGAAATTCT
GGGCAAGACGCTGCCGACAACGTCCAACTTTTACATTTCCTACTTTATCGTGCAGGGCTTGACCATTTCAGTCGG
CGTCTTGACCCAGGTTGTTGGCATGTTCATCTTTCGAATTCTCTACAAGTTTCTTGCTGGCACGCCGAGAGCCAT
GTACACCAAGTGGACCACGCTCAGCGCCATTCTCTGGGGCAGTCTTTTGCCCGTTTACACCAACATTATCTGCAT
TAGTAAGTTGTCGAGTCGAGTAGTGGATGCAAAATGTCTAACGCTTGTTGCTAGGTCTCGTCTTTTCCGTTATTG
CCCCCATCATTTTGTTTTGGTCAACGCTTGGCCTGGCCCTCTTTTACTTTGCCTACCGCTACAACGTCTTTTTCG
TTTCCGAGTCGTCTGTTGACACGCAGGGCCTCATTTACCCCCGCGCGCTCAAGCAGCTCTTTACCGGTATCTATT
TGGCCGAGATTTGCATGGTTGGCCTCTTCGCCGTGGTCAAGGCTCCCGGACCGGCGGTGCTCATGGCTGCCTTTC
TCGTCTTTACCATTCTCTTCCAAATCACCATGTTTAAGAATCTGGATCCCCTGCTCTATGCCTTGCCGCGCAGCG
TGCAGGCGCAAGAGCACTTGATTCGATCTGGCCTTAGCGAGCCCGATGTTTCCCACGAGACGAGCACGGAAAAGG
GCGCGGCTCTCAAGAATGTCAGCGGCAGCGGTGCCAAGGGCAAGGGCAACATTTTTATGCGCTTCATCAAGCCTT
GGATGTACAATGACTATGAGGCGATGCGCCGGCTCGTTCCCCAGGACGAAGGCATGGACCTGCAGAGCCAGTACA
CGGAAAAGGTGGAGGCGTCGGCCTACCTGCCGCCGTCTGTGACGAGCGAAGTGCCGACTCTGTGGATTCCTCGCG
ACGCGGCTGGCGTGTCGCAGCAAGAGGTGGCGGCATCGAGCAAGGTGATTCCGATTACGGACGAGGGCGCCACGA
TTGACGAAAAGAATAATATTATTTGGGACACTGAAGGTGCACGGCCGCCCGTGTGGGAGGAAAAGGTTGTTTACT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail