Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|679
Gene name
LocationContig_112:21847..23896
Strand+
Gene length (bp)2049
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 1.7E-12 303 559

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 287 682 6.0E-50
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 227 682 1.0E-40
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 242 679 3.0E-26
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 242 679 4.0E-26
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 277 682 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 287 682 6.0E-50
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 227 682 1.0E-40
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 242 679 3.0E-26
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 242 679 4.0E-26
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 277 682 2.0E-25
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 270 655 6.0E-25
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 270 655 6.0E-25
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 270 655 7.0E-25
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 270 681 1.0E-24
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 270 679 1.0E-24
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 270 655 1.0E-24
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 242 681 2.0E-24
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 362 681 7.0E-24
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 274 679 7.0E-24
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 353 681 2.0E-23
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 272 679 3.0E-23
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 357 682 5.0E-23
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 298 679 7.0E-23
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 272 681 1.0E-22
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 274 681 1.0E-22
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 357 679 2.0E-22
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 267 679 5.0E-22
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 357 680 7.0E-22
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 357 680 8.0E-22
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 357 680 1.0E-21
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 357 680 1.0E-21
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 357 680 1.0E-21
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 227 681 3.0E-21
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 220 679 3.0E-21
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 410 679 3.0E-21
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 275 672 4.0E-21
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 410 679 1.0E-20
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 272 682 1.0E-20
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 247 679 3.0E-20
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 275 672 4.0E-20
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 362 681 8.0E-20
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 362 681 1.0E-19
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 218 679 5.0E-19
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 203 677 1.0E-18
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 293 679 4.0E-18
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 279 682 6.0E-18
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 357 679 8.0E-18
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 225 682 1.0E-17
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 364 680 5.0E-17
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 333 681 6.0E-17
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 274 682 2.0E-16
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 303 681 4.0E-16
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 413 679 6.0E-16
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 366 672 1.0E-15
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 227 682 1.0E-15
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 357 679 1.0E-15
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 349 605 8.0E-15
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 247 590 1.0E-14
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 293 681 1.0E-14
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 232 679 3.0E-14
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 358 678 3.0E-14
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 267 590 4.0E-14
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 333 679 9.0E-14
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 227 621 1.0E-13
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 227 621 1.0E-13
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 229 681 5.0E-13
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 199 590 6.0E-13
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 304 680 7.0E-13
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 428 681 3.0E-12
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 220 624 6.0E-12
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 319 681 1.0E-11
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 227 620 2.0E-11
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 227 679 2.0E-11
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 325 674 2.0E-11
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 428 614 3.0E-11
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 428 616 4.0E-11
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 227 608 4.0E-09
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 229 681 4.0E-09
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 338 681 4.0E-08
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 311 679 4.0E-08
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 229 558 6.0E-08
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 316 595 2.0E-07
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 227 592 6.0E-07
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 393 679 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140359 ABC-type transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0022804 active transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No
GO:0097367 carbohydrate derivative binding No
GO:0110165 cellular anatomical entity No
GO:0017076 purine nucleotide binding No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0140657 ATP-dependent activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0030554 adenyl nucleotide binding No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 101 123 22
3 130 147 17
4 157 179 22
5 291 313 22
6 323 345 22
7 422 444 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|679
MLQCRQGGHAICLLHVICGIVIPLVASVLSAALLAVQLYRQRLKRLKATDDERRPLLAGSYPVYGTAVDEESIRN
VDASCPSPWLRFLAVGNDQLRRLEKGVLMADIALGIALVVFAARLGLHIPMGSSLAMISSSSYLLCLLVISTRFD
KPWTMQYHLGVLFLAQYLCILATTHSVIFDFAPKPLAIALSLRPIGYTLLLLRHVRSGIIRIGPALLDFEADISK
PAGLVSRLTLSWIQNGGETRLDSPELQDILTSASSGDLSACKNVSHSSSLLPTLLRHVGSDLLRQGAWAALASLL
LFAPALILRAILIGIESSEAIQTHMAWFLVSSLLISGLISGIANAQCQWTGSKIYARLNGLITSDIYERMLQLPL
IADASKTILTNGTILSNINVDAPVISEMGAHLHLLWITMPTQLVFAICALYSISGISGIFGLAVYIVFLPALVFF
LKEHAAAEQKTLAATRTRTESTADFLSAIRAIKYFAWEKCIQTQLSGLREEELCKKKSRILWGSAFSTACCSMPL
IATASSFLFQSVVLHTTLRSSTAFPVIVVFAALRLPMERAAQVMALASQAHISVKRIDETLREQEKEVGQRLPCI
NSGKLGFEGATLRWPTDGDPSRREHWPMIEAMLSAFRLGDLNIEFLIGKINVVFGHPGCGKSSLLLALLGEMEIV
GGSVFIP*
Coding >OphauB2|679
ATGCTGCAATGCAGGCAGGGCGGCCACGCCATTTGCCTCCTGCATGTCATCTGCGGTATTGTCATTCCTCTCGTG
GCCTCGGTTCTCTCAGCGGCCCTGCTGGCTGTTCAGCTTTATCGACAACGCCTCAAGCGCCTCAAAGCGACCGAC
GATGAGCGTAGACCACTACTAGCAGGCTCCTACCCAGTTTATGGAACAGCTGTGGATGAAGAAAGCATTCGAAAT
GTCGACGCGTCCTGTCCTTCGCCATGGCTGCGCTTTCTTGCCGTTGGAAATGATCAATTGAGAAGGCTCGAAAAA
GGCGTGCTCATGGCTGACATTGCCCTCGGCATCGCTCTGGTTGTTTTCGCAGCTCGACTTGGTCTGCACATCCCA
ATGGGCTCTTCTTTGGCAATGATTTCGTCATCATCCTATTTATTGTGTCTGCTCGTCATTAGCACCCGCTTTGAC
AAGCCTTGGACCATGCAGTATCATCTTGGAGTTCTCTTTCTAGCGCAATACCTTTGCATTCTAGCCACCACTCAC
TCTGTCATCTTCGACTTCGCCCCCAAGCCTCTCGCCATCGCTTTGTCACTCCGCCCCATCGGCTATACCTTGTTG
CTCCTCAGACATGTCAGGTCGGGTATAATACGAATCGGTCCCGCACTTCTTGATTTCGAGGCGGATATTTCCAAG
CCTGCAGGCCTCGTCTCCCGCCTCACGTTATCATGGATTCAAAATGGAGGAGAAACAAGGCTCGATTCCCCCGAG
CTCCAAGATATCCTTACATCAGCCAGTTCGGGAGATCTTTCAGCTTGCAAGAACGTCTCTCATTCCTCGTCGCTG
CTTCCAACACTGCTGCGACATGTCGGTAGCGACCTCTTGCGCCAAGGTGCATGGGCTGCTCTGGCCAGTCTTCTT
CTATTTGCCCCGGCTTTAATTCTGCGCGCCATTCTTATCGGCATAGAATCTTCAGAGGCAATACAGACCCACATG
GCTTGGTTTCTTGTCAGCAGTCTTTTAATCTCAGGCCTCATATCAGGCATCGCGAATGCCCAATGCCAATGGACT
GGCTCCAAGATTTATGCGAGGCTCAACGGCCTTATTACGAGCGACATTTATGAAAGAATGCTACAGCTGCCTTTA
ATCGCCGACGCAAGCAAGACGATTCTTACGAATGGCACTATTCTCAGCAATATCAACGTCGACGCCCCCGTCATT
AGCGAAATGGGCGCTCATCTCCATCTATTGTGGATCACTATGCCGACGCAGCTAGTCTTCGCTATTTGCGCTCTC
TATAGCATCAGCGGCATCAGCGGCATCTTTGGCCTCGCTGTGTATATCGTCTTTCTCCCCGCCTTGGTTTTCTTC
TTGAAAGAGCACGCTGCAGCAGAGCAAAAAACTCTGGCTGCAACGAGGACGCGAACAGAATCGACGGCCGACTTT
CTTTCAGCCATTCGCGCTATCAAGTACTTTGCATGGGAGAAGTGCATCCAAACTCAGCTTTCGGGTCTTCGAGAA
GAGGAACTATGCAAGAAAAAGAGCCGAATTCTCTGGGGGTCTGCATTTAGTACCGCATGCTGTTCTATGCCTCTG
ATCGCCACAGCGTCTTCATTCTTATTCCAAAGTGTGGTGTTACATACCACTCTTAGAAGCTCGACTGCCTTTCCA
GTAATAGTCGTCTTTGCCGCTTTGCGTTTGCCTATGGAGCGAGCGGCTCAAGTAATGGCCCTTGCATCGCAAGCC
CACATTTCGGTCAAGCGAATTGATGAGACTTTACGCGAACAAGAAAAAGAAGTAGGACAGCGTTTACCTTGCATC
AATAGTGGAAAGCTTGGTTTCGAGGGCGCTACCCTCCGTTGGCCGACTGATGGTGATCCCAGTCGACGTGAACAT
TGGCCTATGATAGAAGCAATGCTATCTGCCTTCCGCCTTGGCGACTTGAATATCGAATTCTTGATTGGCAAGATT
AATGTTGTCTTTGGCCATCCCGGCTGCGGAAAATCGTCATTATTGCTGGCCTTACTCGGAGAAATGGAGATTGTC
GGTGGGAGTGTTTTTATACCTTAG
Transcript >OphauB2|679
ATGCTGCAATGCAGGCAGGGCGGCCACGCCATTTGCCTCCTGCATGTCATCTGCGGTATTGTCATTCCTCTCGTG
GCCTCGGTTCTCTCAGCGGCCCTGCTGGCTGTTCAGCTTTATCGACAACGCCTCAAGCGCCTCAAAGCGACCGAC
GATGAGCGTAGACCACTACTAGCAGGCTCCTACCCAGTTTATGGAACAGCTGTGGATGAAGAAAGCATTCGAAAT
GTCGACGCGTCCTGTCCTTCGCCATGGCTGCGCTTTCTTGCCGTTGGAAATGATCAATTGAGAAGGCTCGAAAAA
GGCGTGCTCATGGCTGACATTGCCCTCGGCATCGCTCTGGTTGTTTTCGCAGCTCGACTTGGTCTGCACATCCCA
ATGGGCTCTTCTTTGGCAATGATTTCGTCATCATCCTATTTATTGTGTCTGCTCGTCATTAGCACCCGCTTTGAC
AAGCCTTGGACCATGCAGTATCATCTTGGAGTTCTCTTTCTAGCGCAATACCTTTGCATTCTAGCCACCACTCAC
TCTGTCATCTTCGACTTCGCCCCCAAGCCTCTCGCCATCGCTTTGTCACTCCGCCCCATCGGCTATACCTTGTTG
CTCCTCAGACATGTCAGGTCGGGTATAATACGAATCGGTCCCGCACTTCTTGATTTCGAGGCGGATATTTCCAAG
CCTGCAGGCCTCGTCTCCCGCCTCACGTTATCATGGATTCAAAATGGAGGAGAAACAAGGCTCGATTCCCCCGAG
CTCCAAGATATCCTTACATCAGCCAGTTCGGGAGATCTTTCAGCTTGCAAGAACGTCTCTCATTCCTCGTCGCTG
CTTCCAACACTGCTGCGACATGTCGGTAGCGACCTCTTGCGCCAAGGTGCATGGGCTGCTCTGGCCAGTCTTCTT
CTATTTGCCCCGGCTTTAATTCTGCGCGCCATTCTTATCGGCATAGAATCTTCAGAGGCAATACAGACCCACATG
GCTTGGTTTCTTGTCAGCAGTCTTTTAATCTCAGGCCTCATATCAGGCATCGCGAATGCCCAATGCCAATGGACT
GGCTCCAAGATTTATGCGAGGCTCAACGGCCTTATTACGAGCGACATTTATGAAAGAATGCTACAGCTGCCTTTA
ATCGCCGACGCAAGCAAGACGATTCTTACGAATGGCACTATTCTCAGCAATATCAACGTCGACGCCCCCGTCATT
AGCGAAATGGGCGCTCATCTCCATCTATTGTGGATCACTATGCCGACGCAGCTAGTCTTCGCTATTTGCGCTCTC
TATAGCATCAGCGGCATCAGCGGCATCTTTGGCCTCGCTGTGTATATCGTCTTTCTCCCCGCCTTGGTTTTCTTC
TTGAAAGAGCACGCTGCAGCAGAGCAAAAAACTCTGGCTGCAACGAGGACGCGAACAGAATCGACGGCCGACTTT
CTTTCAGCCATTCGCGCTATCAAGTACTTTGCATGGGAGAAGTGCATCCAAACTCAGCTTTCGGGTCTTCGAGAA
GAGGAACTATGCAAGAAAAAGAGCCGAATTCTCTGGGGGTCTGCATTTAGTACCGCATGCTGTTCTATGCCTCTG
ATCGCCACAGCGTCTTCATTCTTATTCCAAAGTGTGGTGTTACATACCACTCTTAGAAGCTCGACTGCCTTTCCA
GTAATAGTCGTCTTTGCCGCTTTGCGTTTGCCTATGGAGCGAGCGGCTCAAGTAATGGCCCTTGCATCGCAAGCC
CACATTTCGGTCAAGCGAATTGATGAGACTTTACGCGAACAAGAAAAAGAAGTAGGACAGCGTTTACCTTGCATC
AATAGTGGAAAGCTTGGTTTCGAGGGCGCTACCCTCCGTTGGCCGACTGATGGTGATCCCAGTCGACGTGAACAT
TGGCCTATGATAGAAGCAATGCTATCTGCCTTCCGCCTTGGCGACTTGAATATCGAATTCTTGATTGGCAAGATT
AATGTTGTCTTTGGCCATCCCGGCTGCGGAAAATCGTCATTATTGCTGGCCTTACTCGGAGAAATGGAGATTGTC
GGTGGGAGTGTTTTTATACCTTAG
Gene >OphauB2|679
ATGCTGCAATGCAGGCAGGGCGGCCACGCCATTTGCCTCCTGCATGTCATCTGCGGTATTGTCATTCCTCTCGTG
GCCTCGGTTCTCTCAGCGGCCCTGCTGGCTGTTCAGCTTTATCGACAACGCCTCAAGCGCCTCAAAGCGACCGAC
GATGAGCGTAGACCACTACTAGCAGGCTCCTACCCAGTTTATGGAACAGCTGTGGATGAAGAAAGCATTCGAAAT
GTCGACGCGTCCTGTCCTTCGCCATGGCTGCGCTTTCTTGCCGTTGGAAATGATCAATTGAGAAGGCTCGAAAAA
GGCGTGCTCATGGCTGACATTGCCCTCGGCATCGCTCTGGTTGTTTTCGCAGCTCGACTTGGTCTGCACATCCCA
ATGGGCTCTTCTTTGGCAATGATTTCGTCATCATCCTATTTATTGTGTCTGCTCGTCATTAGCACCCGCTTTGAC
AAGCCTTGGACCATGCAGTATCATCTTGGAGTTCTCTTTCTAGCGCAATACCTTTGCATTCTAGCCACCACTCAC
TCTGTCATCTTCGACTTCGCCCCCAAGCCTCTCGCCATCGCTTTGTCACTCCGCCCCATCGGCTATACCTTGTTG
CTCCTCAGACATGTCAGGTCGGGTATAATACGAATCGGTCCCGCACTTCTTGATTTCGAGGCGGATATTTCCAAG
CCTGCAGGCCTCGTCTCCCGCCTCACGTTATCATGGATTCAAAATGGAGGAGAAACAAGGCTCGATTCCCCCGAG
CTCCAAGATATCCTTACATCAGCCAGTTCGGGAGATCTTTCAGCTTGCAAGAACGTCTCTCATTCCTCGTCGCTG
CTTCCAACACTGCTGCGACATGTCGGTAGCGACCTCTTGCGCCAAGGTGCATGGGCTGCTCTGGCCAGTCTTCTT
CTATTTGCCCCGGCTTTAATTCTGCGCGCCATTCTTATCGGCATAGAATCTTCAGAGGCAATACAGACCCACATG
GCTTGGTTTCTTGTCAGCAGTCTTTTAATCTCAGGCCTCATATCAGGCATCGCGAATGCCCAATGCCAATGGACT
GGCTCCAAGATTTATGCGAGGCTCAACGGCCTTATTACGAGCGACATTTATGAAAGAATGCTACAGCTGCCTTTA
ATCGCCGACGCAAGCAAGACGATTCTTACGAATGGCACTATTCTCAGCAATATCAACGTCGACGCCCCCGTCATT
AGCGAAATGGGCGCTCATCTCCATCTATTGTGGATCACTATGCCGACGCAGCTAGTCTTCGCTATTTGCGCTCTC
TATAGCATCAGCGGCATCAGCGGCATCTTTGGCCTCGCTGTGTATATCGTCTTTCTCCCCGCCTTGGTTTTCTTC
TTGAAAGAGCACGCTGCAGCAGAGCAAAAAACTCTGGCTGCAACGAGGACGCGAACAGAATCGACGGCCGACTTT
CTTTCAGCCATTCGCGCTATCAAGTACTTTGCATGGGAGAAGTGCATCCAAACTCAGCTTTCGGGTCTTCGAGAA
GAGGAACTATGCAAGAAAAAGAGCCGAATTCTCTGGGGGTCTGCATTTAGTACCGCATGCTGTTCTATGCCTCTG
ATCGCCACAGCGTCTTCATTCTTATTCCAAAGTGTGGTGTTACATACCACTCTTAGAAGCTCGACTGCCTTTCCA
GTAATAGTCGTCTTTGCCGCTTTGCGTTTGCCTATGGAGCGAGCGGCTCAAGTAATGGCCCTTGCATCGCAAGCC
CACATTTCGGTCAAGCGAATTGATGAGACTTTACGCGAACAAGAAAAAGAAGTAGGACAGCGTTTACCTTGCATC
AATAGTGGAAAGCTTGGTTTCGAGGGCGCTACCCTCCGTTGGCCGACTGATGGTGATCCCAGTCGACGTGAACAT
TGGCCTATGATAGAAGCAATGCTATCTGCCTTCCGCCTTGGCGACTTGAATATCGAATTCTTGATTGGCAAGATT
AATGTTGTCTTTGGCCATCCCGGCTGCGGAAAATCGTCATTATTGCTGGCCTTACTCGGAGAAATGGAGATTGTC
GGTGGGAGTGTTTTTATACCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail