Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6789
Gene name
LocationContig_65:92384..93458
Strand+
Gene length (bp)1074
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08538 DUF1749 Protein of unknown function (DUF1749) 5.4E-71 29 309

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9C0Y8|YKM6_SCHPO UPF0613 protein PB24D3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.06c PE=3 SV=1 50 310 2.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6789
MSRLACYFAVLTALVSPIAMATTESTFTVTVHPYGSDDNYTRNYAYEYGTTASENAIIFINGLYGGPHTNPFVRR
VADQIQKAQNLSYSVFEIRLNSAFTAFGAYSIFDDAADISVLVKYLRSIRKRNIVLYGHSSGCQDCMAYIDNAKH
DNPSVDGFILQAPVSDREYLQTRNFYHRKLDAASKLIEAGKPNECIPREGGVGPPLTAYRVYSLYAKGGDEDFFS
SDLSNETVTGFWQRFQKPVLVLFSENDQFVPQNIDQKKKLQRYREANPQQVSQLSGLIPNATHSLVGDTEAHGWL
ADKVEAFLRTL*
Coding >OphauB2|6789
ATGTCGCGGCTCGCGTGCTACTTTGCAGTGCTCACTGCCCTCGTCTCACCCATAGCAATGGCAACGACCGAGTCC
ACCTTTACCGTCACGGTACATCCGTATGGCTCCGACGACAATTACACAAGGAATTATGCCTATGAATACGGAACG
ACAGCTTCCGAGAATGCCATCATCTTCATCAACGGCCTATACGGCGGACCCCATACAAATCCCTTTGTCCGTCGT
GTGGCCGACCAGATCCAAAAGGCACAAAATCTCAGCTACTCTGTATTTGAAATCAGACTGAATAGCGCATTTACC
GCCTTTGGAGCGTATAGCATTTTTGATGATGCTGCTGACATTTCCGTCCTTGTCAAGTACCTTCGCAGCATTAGA
AAGCGCAACATAGTGCTCTACGGGCACTCTAGCGGCTGTCAAGACTGCATGGCGTACATTGATAATGCCAAACAC
GATAACCCGTCCGTTGATGGCTTCATCCTCCAGGCACCCGTGTCGGACCGCGAATACCTTCAGACTCGGAACTTC
TACCACCGGAAACTAGACGCTGCCTCTAAGCTGATTGAAGCCGGAAAACCAAACGAGTGTATTCCGCGCGAGGGA
GGTGTCGGACCTCCCCTGACAGCGTACCGAGTGTATTCGCTCTATGCCAAAGGTGGCGACGAAGACTTCTTCTCT
TCCGACTTGAGCAATGAGACGGTGACGGGTTTTTGGCAAAGATTCCAGAAGCCTGTCTTGGTGCTATTTTCAGAA
AACGACCAATTTGTGCCACAAAATATTGACCAGAAGAAAAAGCTGCAAAGGTACCGCGAGGCAAACCCGCAGCAG
GTCAGTCAACTGTCGGGATTGATTCCTAATGCCACACACAGCCTGGTGGGGGACACGGAGGCGCATGGCTGGCTG
GCAGACAAGGTGGAAGCCTTTTTGCGGACTTTGTGA
Transcript >OphauB2|6789
ATGTCGCGGCTCGCGTGCTACTTTGCAGTGCTCACTGCCCTCGTCTCACCCATAGCAATGGCAACGACCGAGTCC
ACCTTTACCGTCACGGTACATCCGTATGGCTCCGACGACAATTACACAAGGAATTATGCCTATGAATACGGAACG
ACAGCTTCCGAGAATGCCATCATCTTCATCAACGGCCTATACGGCGGACCCCATACAAATCCCTTTGTCCGTCGT
GTGGCCGACCAGATCCAAAAGGCACAAAATCTCAGCTACTCTGTATTTGAAATCAGACTGAATAGCGCATTTACC
GCCTTTGGAGCGTATAGCATTTTTGATGATGCTGCTGACATTTCCGTCCTTGTCAAGTACCTTCGCAGCATTAGA
AAGCGCAACATAGTGCTCTACGGGCACTCTAGCGGCTGTCAAGACTGCATGGCGTACATTGATAATGCCAAACAC
GATAACCCGTCCGTTGATGGCTTCATCCTCCAGGCACCCGTGTCGGACCGCGAATACCTTCAGACTCGGAACTTC
TACCACCGGAAACTAGACGCTGCCTCTAAGCTGATTGAAGCCGGAAAACCAAACGAGTGTATTCCGCGCGAGGGA
GGTGTCGGACCTCCCCTGACAGCGTACCGAGTGTATTCGCTCTATGCCAAAGGTGGCGACGAAGACTTCTTCTCT
TCCGACTTGAGCAATGAGACGGTGACGGGTTTTTGGCAAAGATTCCAGAAGCCTGTCTTGGTGCTATTTTCAGAA
AACGACCAATTTGTGCCACAAAATATTGACCAGAAGAAAAAGCTGCAAAGGTACCGCGAGGCAAACCCGCAGCAG
GTCAGTCAACTGTCGGGATTGATTCCTAATGCCACACACAGCCTGGTGGGGGACACGGAGGCGCATGGCTGGCTG
GCAGACAAGGTGGAAGCCTTTTTGCGGACTTTGTGA
Gene >OphauB2|6789
ATGTCGCGGCTCGCGTGCTACTTTGCAGTGCTCACTGCCCTCGTCTCACCCATAGCAATGGCAACGACCGAGTCC
ACCTTTACCGTCACGGTACATCCGTATGGCTCCGACGACAATTACACAAGGAATTATGCCTATGAATACGGAACG
ACAGCTTCCGAGAATGCCATCATCTTCATCAACGGCCTATACGGCGGACCCCATACAAATCCCTTTGTCCGTCGT
GTGGCCGACCAGATCCAAAAGGCACAAAATCTCAGCTACTCTGTATTTGAAATCAGACTGAATAGCGCATTTACC
GCCTTTGGAGCGTATAGCATTTTTGATGATGCTGCTGACATTTCCGTCCTTGTCAAGTACCTTCGCAGCATTAGA
AAGCGCAACATAGTGCTCTACGGGCACTCTAGCGGCTGTCAAGTGCGTCTGTGTGCCTTGTCGCCAGCGCCCGAG
GTGTGCTGACGTGGTCAACCTTCAGGACTGCATGGCGTACATTGATAATGCCAAACACGATAACCCGTCCGTTGA
TGGCTTCATCCTCCAGGCACCCGTGTCGGACCGCGAATACCTTCAGACTCGGAACTTCTACCACCGGAAACTAGA
CGCTGCCTCTAAGCTGATTGAAGCCGGAAAACCAAACGAGTGTATTCCGCGCGAGGGAGGTGTCGGACCTCCCCT
GACAGCGTACCGAGTGTATTCGCTCTATGCCAAAGGGTAAGATTTGACACGGCCCATGCTGCTACTGTAGTCCAC
CAACCGCCCTGTATATCTGACTGTCTTTTTTATTCTTATAGTGGCGACGAAGACTTCTTCTCTTCCGACTTGAGC
AATGAGACGGTGACGGGTTTTTGGCAAAGATTCCAGAAGCCTGTCTTGGTGCTATTTTCAGAAAACGACCAATTT
GTGCCACAAAATATTGACCAGAAGAAAAAGCTGCAAAGGTACCGCGAGGCAAACCCGCAGCAGGTCAGTCAACTG
TCGGGATTGATTCCTAATGCCACACACAGCCTGGTGGGGGACACGGAGGCGCATGGCTGGCTGGCAGACAAGGTG
GAAGCCTTTTTGCGGACTTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail