Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6769
Gene name
LocationContig_65:30021..31866
Strand-
Gene length (bp)1845
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09368 Sas10 Sas10 C-terminal domain 5.7E-29 539 614
PF04000 Sas10_Utp3 Sas10/Utp3/C1D family 1.8E-07 218 300

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTS0|YBH9_SCHPO Uncharacterized protein C3B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.09 PE=1 SV=1 26 614 9.0E-65
sp|Q12136|SAS10_YEAST Something about silencing protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS10 PE=1 SV=1 116 614 3.0E-45
sp|Q9JI13|SAS10_MOUSE Something about silencing protein 10 OS=Mus musculus GN=Utp3 PE=1 SV=1 539 614 5.0E-09
sp|Q9NQZ2|SAS10_HUMAN Something about silencing protein 10 OS=Homo sapiens GN=UTP3 PE=1 SV=1 539 614 6.0E-09
sp|Q6AXX4|SAS10_RAT Something about silencing protein 10 OS=Rattus norvegicus GN=Utp3 PE=1 SV=1 539 614 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTS0|YBH9_SCHPO Uncharacterized protein C3B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.09 PE=1 SV=1 26 614 9.0E-65
sp|Q12136|SAS10_YEAST Something about silencing protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS10 PE=1 SV=1 116 614 3.0E-45
sp|Q9JI13|SAS10_MOUSE Something about silencing protein 10 OS=Mus musculus GN=Utp3 PE=1 SV=1 539 614 5.0E-09
sp|Q9NQZ2|SAS10_HUMAN Something about silencing protein 10 OS=Homo sapiens GN=UTP3 PE=1 SV=1 539 614 6.0E-09
sp|Q6AXX4|SAS10_RAT Something about silencing protein 10 OS=Rattus norvegicus GN=Utp3 PE=1 SV=1 539 614 6.0E-09
sp|Q9I7W5|SAS10_DROME Something about silencing protein 10 OS=Drosophila melanogaster GN=Sas10 PE=1 SV=2 540 614 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6769
MGKKRKASRRDAEPAGPKALDPADARLGPISSYADVANSEDEYFLNRENILLDDEPESKRRRKDNKDIELSDEEI
FGYQESDSDDATQFSSSNKKQISSKDDGSSDQETEAHNQQDEGWWGDSRREYYDADNIETEADALEEEAEAKRLQ
KKKLSKMREEDFVFDGDAWLASEPGPENEKETTLEVLNEIEVSDDMNSQERLKLLVARYPEFEHLVVEMQNLLPM
LEVVKSEAVARPSTSLHVVKYWTLGCYVAALASYFAIMTSPARDDEKTSRPMAPSELRDHGVMEALVKCRNAWQR
VKEAKPLTSPADISLPGADSLGDAGIVSDSAVDKSAKMKLSKDSNTATAKQAKKLAKAKAIEASVLDLYNIPSLA
ASKSKRQGKSSLQARQNLDNNSDFGEEEGLDVRTAAEKAARKKSLKFYTSQIVQKASRRAGAGRDAGGDADIPYR
ERFRDKQARLLAEAKKRGSKESKHGADLGGESDDDDAKAATAVRNDVDEYLQKVLQAAKTKRENKQARYAAYAAA
SKTDRVVEKEEIGEDGKRKITYAIEKNKGLAPRRSKDVRNPRVKRRKQFEAKQKKLKSMKPVWQGGEPKGGYHGE
LSGINTAVVKSTKL*
Coding >OphauB2|6769
ATGGGCAAGAAGAGAAAGGCATCCCGGCGCGATGCCGAGCCGGCGGGTCCCAAAGCTCTTGACCCTGCTGACGCC
CGGCTTGGCCCCATCTCAAGCTATGCAGACGTTGCCAACTCTGAGGATGAGTATTTTCTCAATCGTGAAAACATC
CTGCTCGACGACGAGCCTGAGTCGAAGCGCAGACGCAAGGATAACAAAGACATTGAGCTGTCTGATGAAGAGATT
TTTGGCTACCAAGAGTCGGATTCCGATGATGCTACACAGTTTTCCAGCAGCAATAAAAAACAGATTTCCAGCAAA
GACGACGGCTCTTCCGATCAAGAGACTGAAGCCCATAACCAACAAGATGAAGGCTGGTGGGGGGATTCCAGACGC
GAGTACTACGATGCCGATAATATCGAAACCGAAGCCGACGCACTGGAAGAAGAAGCCGAGGCCAAGCGGCTGCAG
AAGAAGAAGCTGTCCAAGATGCGCGAAGAAGATTTTGTCTTTGACGGCGATGCATGGCTAGCATCCGAGCCTGGG
CCAGAGAATGAAAAGGAAACTACTCTCGAAGTCCTCAACGAGATTGAAGTCAGTGACGACATGAATTCCCAAGAA
AGATTAAAGCTTCTAGTAGCAAGGTATCCCGAGTTTGAGCATCTTGTCGTTGAGATGCAAAACTTGCTGCCGATG
CTCGAGGTAGTCAAGTCGGAGGCTGTGGCAAGACCCAGCACCTCTCTCCACGTGGTCAAATACTGGACCCTGGGT
TGCTACGTTGCAGCACTGGCTAGCTACTTTGCCATCATGACATCTCCGGCGCGCGACGACGAAAAAACTTCAAGA
CCCATGGCACCTTCAGAGCTGAGAGATCATGGTGTTATGGAGGCATTGGTCAAATGTCGGAACGCGTGGCAACGC
GTAAAGGAAGCCAAACCCCTGACAAGCCCTGCCGATATTTCCCTTCCCGGAGCCGACTCTCTTGGGGATGCTGGC
ATCGTTTCGGATTCGGCTGTTGACAAGAGTGCCAAGATGAAATTGTCCAAGGATAGCAATACAGCTACAGCCAAG
CAAGCCAAGAAGCTTGCAAAGGCAAAGGCAATCGAAGCGAGCGTTTTAGACCTTTATAATATCCCCTCTCTTGCC
GCAAGCAAGTCAAAACGACAGGGCAAATCGTCACTGCAGGCGAGACAAAACTTGGACAACAACTCGGACTTTGGC
GAAGAAGAGGGATTGGATGTGCGCACAGCCGCAGAAAAGGCGGCGAGGAAAAAGAGCCTCAAGTTCTACACATCG
CAGATTGTACAAAAGGCTAGCCGCCGGGCTGGTGCTGGACGCGATGCCGGTGGCGATGCTGACATTCCATATCGA
GAACGCTTTCGAGACAAACAGGCTCGTCTACTAGCCGAGGCAAAGAAACGCGGATCCAAAGAGTCCAAGCACGGG
GCCGACCTGGGCGGGGAGAGCGACGACGACGATGCCAAAGCTGCCACAGCCGTGCGGAATGATGTAGACGAATAC
CTCCAGAAGGTGTTACAGGCTGCCAAGACGAAGCGGGAAAACAAGCAAGCCCGCTATGCAGCCTACGCAGCGGCA
AGCAAGACGGACCGGGTGGTGGAAAAGGAGGAAATTGGCGAAGACGGCAAACGCAAGATAACGTATGCCATTGAG
AAGAACAAGGGGCTCGCACCTAGACGTAGCAAGGACGTTAGGAACCCCAGAGTCAAGCGGCGGAAGCAGTTTGAG
GCCAAGCAGAAGAAGCTCAAGAGCATGAAGCCTGTATGGCAAGGGGGAGAGCCCAAGGGAGGCTACCATGGCGAG
CTGTCTGGTATCAACACGGCCGTGGTTAAGAGCACCAAACTGTAA
Transcript >OphauB2|6769
ATGGGCAAGAAGAGAAAGGCATCCCGGCGCGATGCCGAGCCGGCGGGTCCCAAAGCTCTTGACCCTGCTGACGCC
CGGCTTGGCCCCATCTCAAGCTATGCAGACGTTGCCAACTCTGAGGATGAGTATTTTCTCAATCGTGAAAACATC
CTGCTCGACGACGAGCCTGAGTCGAAGCGCAGACGCAAGGATAACAAAGACATTGAGCTGTCTGATGAAGAGATT
TTTGGCTACCAAGAGTCGGATTCCGATGATGCTACACAGTTTTCCAGCAGCAATAAAAAACAGATTTCCAGCAAA
GACGACGGCTCTTCCGATCAAGAGACTGAAGCCCATAACCAACAAGATGAAGGCTGGTGGGGGGATTCCAGACGC
GAGTACTACGATGCCGATAATATCGAAACCGAAGCCGACGCACTGGAAGAAGAAGCCGAGGCCAAGCGGCTGCAG
AAGAAGAAGCTGTCCAAGATGCGCGAAGAAGATTTTGTCTTTGACGGCGATGCATGGCTAGCATCCGAGCCTGGG
CCAGAGAATGAAAAGGAAACTACTCTCGAAGTCCTCAACGAGATTGAAGTCAGTGACGACATGAATTCCCAAGAA
AGATTAAAGCTTCTAGTAGCAAGGTATCCCGAGTTTGAGCATCTTGTCGTTGAGATGCAAAACTTGCTGCCGATG
CTCGAGGTAGTCAAGTCGGAGGCTGTGGCAAGACCCAGCACCTCTCTCCACGTGGTCAAATACTGGACCCTGGGT
TGCTACGTTGCAGCACTGGCTAGCTACTTTGCCATCATGACATCTCCGGCGCGCGACGACGAAAAAACTTCAAGA
CCCATGGCACCTTCAGAGCTGAGAGATCATGGTGTTATGGAGGCATTGGTCAAATGTCGGAACGCGTGGCAACGC
GTAAAGGAAGCCAAACCCCTGACAAGCCCTGCCGATATTTCCCTTCCCGGAGCCGACTCTCTTGGGGATGCTGGC
ATCGTTTCGGATTCGGCTGTTGACAAGAGTGCCAAGATGAAATTGTCCAAGGATAGCAATACAGCTACAGCCAAG
CAAGCCAAGAAGCTTGCAAAGGCAAAGGCAATCGAAGCGAGCGTTTTAGACCTTTATAATATCCCCTCTCTTGCC
GCAAGCAAGTCAAAACGACAGGGCAAATCGTCACTGCAGGCGAGACAAAACTTGGACAACAACTCGGACTTTGGC
GAAGAAGAGGGATTGGATGTGCGCACAGCCGCAGAAAAGGCGGCGAGGAAAAAGAGCCTCAAGTTCTACACATCG
CAGATTGTACAAAAGGCTAGCCGCCGGGCTGGTGCTGGACGCGATGCCGGTGGCGATGCTGACATTCCATATCGA
GAACGCTTTCGAGACAAACAGGCTCGTCTACTAGCCGAGGCAAAGAAACGCGGATCCAAAGAGTCCAAGCACGGG
GCCGACCTGGGCGGGGAGAGCGACGACGACGATGCCAAAGCTGCCACAGCCGTGCGGAATGATGTAGACGAATAC
CTCCAGAAGGTGTTACAGGCTGCCAAGACGAAGCGGGAAAACAAGCAAGCCCGCTATGCAGCCTACGCAGCGGCA
AGCAAGACGGACCGGGTGGTGGAAAAGGAGGAAATTGGCGAAGACGGCAAACGCAAGATAACGTATGCCATTGAG
AAGAACAAGGGGCTCGCACCTAGACGTAGCAAGGACGTTAGGAACCCCAGAGTCAAGCGGCGGAAGCAGTTTGAG
GCCAAGCAGAAGAAGCTCAAGAGCATGAAGCCTGTATGGCAAGGGGGAGAGCCCAAGGGAGGCTACCATGGCGAG
CTGTCTGGTATCAACACGGCCGTGGTTAAGAGCACCAAACTGTAA
Gene >OphauB2|6769
ATGGGCAAGAAGAGAAAGGCATCCCGGCGCGATGCCGAGCCGGCGGGTCCCAAAGCTCTTGACCCTGCTGACGCC
CGGCTTGGCCCCATCTCAAGCTATGCAGACGTTGCCAACTCTGAGGATGAGTATTTTCTCAATCGTGAAAACATC
CTGCTCGACGACGAGCCTGAGTCGAAGCGCAGACGCAAGGATAACAAAGACATTGAGCTGTCTGATGAAGAGATT
TTTGGCTACCAAGAGTCGGATTCCGATGATGCTACACAGTTTTCCAGCAGCAATAAAAAACAGATTTCCAGCAAA
GACGACGGCTCTTCCGATCAAGAGACTGAAGCCCATAACCAACAAGATGAAGGCTGGTGGGGGGATTCCAGACGC
GAGTACTACGATGCCGATAATATCGAAACCGAAGCCGACGCACTGGAAGAAGAAGCCGAGGCCAAGCGGCTGCAG
AAGAAGAAGCTGTCCAAGATGCGCGAAGAAGATTTTGTCTTTGACGGCGATGCATGGCTAGCATCCGAGCCTGGG
CCAGAGAATGAAAAGGAAACTACTCTCGAAGTCCTCAACGAGATTGAAGTCAGTGACGACATGAATTCCCAAGAA
AGATTAAAGCTTCTAGTAGCAAGGTATCCCGAGTTTGAGCATCTTGTCGTTGAGATGCAAAACTTGCTGCCGATG
CTCGAGGTAGTCAAGTCGGAGGCTGTGGCAAGACCCAGCACCTCTCTCCACGTGGTCAAATACTGGACCCTGGGT
TGCTACGTTGCAGCACTGGCTAGCTACTTTGCCATCATGACATCTCCGGCGCGCGACGACGAAAAAACTTCAAGA
CCCATGGCACCTTCAGAGCTGAGAGATCATGGTGTTATGGAGGCATTGGTCAAATGTCGGAACGCGTGGCAACGC
GTAAAGGAAGCCAAACCCCTGACAAGCCCTGCCGATATTTCCCTTCCCGGAGCCGACTCTCTTGGGGATGCTGGC
ATCGTTTCGGATTCGGCTGTTGACAAGAGTGCCAAGATGAAATTGTCCAAGGATAGCAATACAGCTACAGCCAAG
CAAGCCAAGAAGCTTGCAAAGGCAAAGGCAATCGAAGCGAGCGTTTTAGACCTTTATAATATCCCCTCTCTTGCC
GCAAGCAAGTCAAAACGACAGGGCAAATCGTCACTGCAGGCGAGACAAAACTTGGACAACAACTCGGACTTTGGC
GAAGAAGAGGGATTGGATGTGCGCACAGCCGCAGAAAAGGCGGCGAGGAAAAAGAGCCTCAAGTTCTACACATCG
CAGATTGTACAAAAGGCTAGCCGCCGGGCTGGTGCTGGACGCGATGCCGGTGGCGATGCTGACATTCCATATCGA
GAACGCTTTCGAGACAAACAGGCTCGTCTACTAGCCGAGGCAAAGAAACGCGGATCCAAAGAGTCCAAGCACGGG
GCCGACCTGGGCGGGGAGAGCGACGACGACGATGCCAAAGCTGCCACAGCCGTGCGGAATGATGTAGACGAATAC
CTCCAGAAGGTGTTACAGGCTGCCAAGACGAAGCGGGAAAACAAGCAAGCCCGCTATGCAGCCTACGCAGCGGCA
AGCAAGACGGACCGGGTGGTGGAAAAGGAGGAAATTGGCGAAGACGGCAAACGCAAGATAACGTATGCCATTGAG
AAGAACAAGGGGCTCGCACCTAGACGTAGCAAGGACGTTAGGAACCCCAGAGTCAAGCGGCGGAAGCAGTTTGAG
GCCAAGCAGAAGAAGCTCAAGAGCATGAAGCCTGTATGGCAAGGGGGAGAGCCCAAGGGAGGCTACCATGGCGAG
CTGTCTGGTATCAACACGGCCGTGGTTAAGAGCACCAAACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail