Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6766
Gene name
LocationContig_65:21530..23693
Strand-
Gene length (bp)2163
Transcript length (bp)1824
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.1E-54 158 415
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 4.1E-31 157 407
PF00498 FHA FHA domain 1.8E-14 43 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 63 439 5.0E-46
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 38 448 1.0E-35
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 160 416 2.0E-35
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 27 477 5.0E-35
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 62 463 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 63 439 5.0E-46
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 38 448 1.0E-35
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 160 416 2.0E-35
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 27 477 5.0E-35
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 62 463 3.0E-34
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 31 415 7.0E-34
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 27 427 1.0E-33
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 160 415 4.0E-33
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 70 455 3.0E-32
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 153 415 7.0E-31
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 150 415 7.0E-31
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 43 415 8.0E-31
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 88 415 1.0E-30
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 153 415 2.0E-30
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 44 415 2.0E-30
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 153 415 2.0E-30
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 158 415 4.0E-30
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 160 415 1.0E-29
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 160 415 1.0E-29
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 160 415 1.0E-29
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 152 415 3.0E-29
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 160 415 5.0E-29
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 150 415 1.0E-28
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 206 417 2.0E-28
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 157 415 3.0E-28
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 205 503 3.0E-28
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 157 415 3.0E-28
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 150 415 3.0E-28
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 205 534 3.0E-28
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 150 415 4.0E-28
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 150 415 4.0E-28
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 150 415 4.0E-28
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 195 417 4.0E-28
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 150 415 4.0E-28
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 42 424 4.0E-28
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 150 415 4.0E-28
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 150 415 5.0E-28
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 158 417 5.0E-28
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 150 415 5.0E-28
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 206 417 6.0E-28
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 206 417 7.0E-28
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 206 417 7.0E-28
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 205 415 1.0E-27
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 142 415 2.0E-27
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 150 415 2.0E-27
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 142 415 3.0E-27
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 132 415 4.0E-27
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 145 415 4.0E-27
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 142 415 5.0E-27
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 142 415 6.0E-27
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 116 415 9.0E-27
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 153 439 1.0E-26
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 155 415 1.0E-26
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 150 415 2.0E-26
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 150 415 2.0E-26
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 158 415 2.0E-26
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 150 415 2.0E-26
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 150 415 2.0E-26
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 150 415 2.0E-26
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 150 415 2.0E-26
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 155 415 2.0E-26
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 202 431 2.0E-26
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 157 419 2.0E-26
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 148 437 2.0E-26
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 157 419 2.0E-26
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 145 415 3.0E-26
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 160 415 3.0E-26
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 133 416 4.0E-26
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 157 419 4.0E-26
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 149 417 4.0E-26
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 149 415 4.0E-26
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 149 415 4.0E-26
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 149 415 4.0E-26
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 149 415 4.0E-26
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 141 415 4.0E-26
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 141 415 5.0E-26
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 135 415 6.0E-26
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 135 415 6.0E-26
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 152 423 7.0E-26
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 158 423 8.0E-26
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 158 415 9.0E-26
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 160 415 9.0E-26
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 158 430 1.0E-25
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 158 417 1.0E-25
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 160 415 1.0E-25
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 147 407 1.0E-25
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 149 417 1.0E-25
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 134 416 1.0E-25
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 153 439 1.0E-25
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 158 415 1.0E-25
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 149 415 1.0E-25
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 138 417 2.0E-25
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 158 419 2.0E-25
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 159 419 2.0E-25
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 142 415 2.0E-25
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 152 422 2.0E-25
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 150 416 3.0E-25
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 151 416 3.0E-25
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 158 415 3.0E-25
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 158 415 3.0E-25
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 145 418 3.0E-25
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 160 415 3.0E-25
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 149 415 3.0E-25
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 134 415 4.0E-25
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 152 420 4.0E-25
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 153 419 5.0E-25
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 158 416 5.0E-25
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 151 415 5.0E-25
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 149 419 5.0E-25
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 149 415 5.0E-25
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 153 420 5.0E-25
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 152 415 5.0E-25
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 149 415 6.0E-25
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 149 415 6.0E-25
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 149 415 6.0E-25
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 149 415 6.0E-25
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 149 415 6.0E-25
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 149 415 6.0E-25
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 160 415 6.0E-25
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 160 417 8.0E-25
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 206 434 8.0E-25
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 149 415 8.0E-25
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 155 415 8.0E-25
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 121 415 9.0E-25
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 160 415 1.0E-24
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 153 417 1.0E-24
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 149 415 1.0E-24
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 158 415 1.0E-24
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 34 415 1.0E-24
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 158 448 1.0E-24
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 123 419 1.0E-24
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 206 434 2.0E-24
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 152 458 2.0E-24
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 202 431 2.0E-24
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 149 415 2.0E-24
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 158 448 2.0E-24
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 159 406 2.0E-24
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 158 419 2.0E-24
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 158 448 2.0E-24
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 149 415 2.0E-24
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 206 434 2.0E-24
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 160 415 3.0E-24
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 149 415 3.0E-24
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 158 415 3.0E-24
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 34 415 4.0E-24
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 149 415 4.0E-24
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 158 415 4.0E-24
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 149 438 4.0E-24
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 149 438 4.0E-24
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 158 415 5.0E-24
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 145 474 6.0E-24
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 152 416 6.0E-24
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 149 415 6.0E-24
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 151 415 6.0E-24
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 205 415 6.0E-24
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 159 415 7.0E-24
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 158 415 7.0E-24
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 160 406 7.0E-24
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 160 406 7.0E-24
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 153 419 8.0E-24
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 160 406 8.0E-24
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 160 415 8.0E-24
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 152 415 9.0E-24
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 160 415 1.0E-23
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 141 415 1.0E-23
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 158 415 1.0E-23
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 145 415 1.0E-23
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 147 422 1.0E-23
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 145 474 1.0E-23
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 160 417 1.0E-23
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 160 417 1.0E-23
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 153 435 1.0E-23
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 209 415 1.0E-23
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 149 415 1.0E-23
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 149 415 1.0E-23
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 160 415 1.0E-23
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 160 417 1.0E-23
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 155 415 1.0E-23
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 152 418 2.0E-23
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 160 428 2.0E-23
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 148 415 2.0E-23
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 151 416 2.0E-23
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 147 415 2.0E-23
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 158 415 2.0E-23
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 151 417 2.0E-23
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 158 437 2.0E-23
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 152 437 2.0E-23
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 106 415 2.0E-23
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 193 418 2.0E-23
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 147 463 2.0E-23
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 149 436 3.0E-23
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 149 415 3.0E-23
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 149 436 3.0E-23
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 132 422 3.0E-23
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 149 415 3.0E-23
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 132 422 3.0E-23
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 205 415 3.0E-23
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 149 415 3.0E-23
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 149 415 3.0E-23
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 160 406 3.0E-23
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 157 422 4.0E-23
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 137 419 4.0E-23
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 153 415 4.0E-23
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 149 426 4.0E-23
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 149 426 4.0E-23
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 149 414 4.0E-23
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 144 419 4.0E-23
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 137 419 4.0E-23
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 158 415 4.0E-23
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 198 421 4.0E-23
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 144 417 4.0E-23
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 205 415 5.0E-23
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 158 415 5.0E-23
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 31 444 5.0E-23
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 158 415 5.0E-23
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 157 415 5.0E-23
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 151 415 6.0E-23
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 151 415 6.0E-23
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 145 415 6.0E-23
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 152 415 6.0E-23
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 160 415 6.0E-23
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 158 440 6.0E-23
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 148 415 6.0E-23
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 158 414 6.0E-23
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 148 415 6.0E-23
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 157 415 7.0E-23
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 145 381 7.0E-23
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 205 415 7.0E-23
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 148 415 7.0E-23
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 147 381 7.0E-23
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 204 415 7.0E-23
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 147 415 7.0E-23
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 133 415 8.0E-23
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 149 415 8.0E-23
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 152 415 8.0E-23
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 158 354 8.0E-23
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 158 415 8.0E-23
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 149 417 9.0E-23
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 148 415 9.0E-23
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 149 415 9.0E-23
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 149 421 9.0E-23
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 148 415 9.0E-23
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 153 415 1.0E-22
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 157 415 1.0E-22
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 147 415 1.0E-22
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 209 415 1.0E-22
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 209 420 1.0E-22
sp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1 147 415 1.0E-22
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 138 419 1.0E-22
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 204 415 1.0E-22
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 158 428 1.0E-22
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 152 415 1.0E-22
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 148 415 1.0E-22
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 150 408 1.0E-22
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 149 415 1.0E-22
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 160 416 1.0E-22
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 148 415 2.0E-22
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 137 415 2.0E-22
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 152 415 2.0E-22
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 160 416 2.0E-22
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 204 415 2.0E-22
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 148 415 2.0E-22
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 160 417 2.0E-22
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 138 419 2.0E-22
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 152 360 2.0E-22
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 148 415 2.0E-22
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 149 415 2.0E-22
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 147 381 2.0E-22
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 158 415 2.0E-22
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 209 415 2.0E-22
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 148 415 2.0E-22
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 148 415 2.0E-22
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 149 427 2.0E-22
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 159 415 2.0E-22
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 152 478 2.0E-22
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 148 415 2.0E-22
sp|Q63092|CAMKV_RAT CaM kinase-like vesicle-associated protein OS=Rattus norvegicus GN=Camkv PE=1 SV=1 120 415 2.0E-22
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 148 415 2.0E-22
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 152 415 2.0E-22
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 148 415 2.0E-22
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 149 421 2.0E-22
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 152 419 2.0E-22
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 137 422 3.0E-22
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 147 414 3.0E-22
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 145 415 3.0E-22
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 158 354 3.0E-22
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 148 415 3.0E-22
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 205 415 3.0E-22
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 137 415 3.0E-22
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 150 408 3.0E-22
sp|P32485|HOG1_YEAST Mitogen-activated protein kinase HOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOG1 PE=1 SV=2 148 414 3.0E-22
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 148 415 3.0E-22
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 148 415 3.0E-22
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 148 415 3.0E-22
sp|Q9XUJ7|DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans GN=dkf-1 PE=1 SV=1 149 427 3.0E-22
sp|Q6GLS4|CAMKV_XENLA CaM kinase-like vesicle-associated protein OS=Xenopus laevis GN=camkv PE=2 SV=1 195 415 3.0E-22
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 147 415 3.0E-22
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 149 427 4.0E-22
sp|Q6XKY3|HOG1_HYPAT Mitogen-activated protein kinase hog1 OS=Hypocrea atroviridis GN=hog1 PE=3 SV=1 148 415 4.0E-22
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 151 416 4.0E-22
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 158 415 4.0E-22
sp|Q3UHL1|CAMKV_MOUSE CaM kinase-like vesicle-associated protein OS=Mus musculus GN=Camkv PE=1 SV=2 120 415 4.0E-22
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 204 415 4.0E-22
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 148 415 4.0E-22
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 145 417 4.0E-22
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 149 417 4.0E-22
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 152 478 4.0E-22
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 160 420 4.0E-22
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 145 415 4.0E-22
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 158 443 5.0E-22
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 124 446 5.0E-22
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 157 448 5.0E-22
sp|Q8NCB2|CAMKV_HUMAN CaM kinase-like vesicle-associated protein OS=Homo sapiens GN=CAMKV PE=2 SV=2 120 415 5.0E-22
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 142 415 5.0E-22
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 160 415 5.0E-22
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 153 419 5.0E-22
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 160 415 5.0E-22
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 148 415 6.0E-22
sp|O42844|KCC2_SCHPO Calcium/calmodulin-dependent protein kinase type II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk2 PE=1 SV=1 151 415 6.0E-22
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 148 415 6.0E-22
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 159 416 6.0E-22
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 201 416 6.0E-22
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 145 415 6.0E-22
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 149 421 6.0E-22
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 149 415 7.0E-22
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 133 415 7.0E-22
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 152 415 7.0E-22
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 158 415 7.0E-22
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 150 415 7.0E-22
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 152 360 7.0E-22
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 149 414 7.0E-22
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 158 404 7.0E-22
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 153 415 7.0E-22
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 92 415 7.0E-22
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 151 416 8.0E-22
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 160 417 8.0E-22
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 151 415 9.0E-22
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 147 390 9.0E-22
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 142 415 9.0E-22
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 160 415 1.0E-21
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 141 419 1.0E-21
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 204 415 1.0E-21
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 158 384 1.0E-21
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 152 415 1.0E-21
sp|Q1L5Z8|HOG1_TORDE Mitogen-activated protein kinase HOG1 OS=Torulaspora delbrueckii GN=HOG1 PE=1 SV=1 148 415 1.0E-21
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 143 415 1.0E-21
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 156 417 1.0E-21
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 132 415 1.0E-21
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 160 415 1.0E-21
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 148 415 1.0E-21
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 152 417 1.0E-21
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 148 415 1.0E-21
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 160 416 1.0E-21
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 148 415 1.0E-21
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 149 415 1.0E-21
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 148 415 1.0E-21
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 148 415 1.0E-21
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 158 415 1.0E-21
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 148 415 1.0E-21
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 152 416 1.0E-21
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 152 417 1.0E-21
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 148 384 1.0E-21
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 160 415 1.0E-21
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 149 415 1.0E-21
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 149 436 1.0E-21
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 153 415 2.0E-21
sp|Q9HBH9|MKNK2_HUMAN MAP kinase-interacting serine/threonine-protein kinase 2 OS=Homo sapiens GN=MKNK2 PE=1 SV=3 149 415 2.0E-21
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 151 415 2.0E-21
sp|P07313|MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus GN=MYLK2 PE=1 SV=3 136 417 2.0E-21
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 147 381 2.0E-21
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 147 381 2.0E-21
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 147 381 2.0E-21
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 143 415 2.0E-21
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 209 415 2.0E-21
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 148 415 2.0E-21
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 155 423 2.0E-21
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 149 415 2.0E-21
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 152 415 2.0E-21
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 129 420 2.0E-21
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 155 400 2.0E-21
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 152 415 2.0E-21
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 152 435 2.0E-21
sp|O59854|HOG1_ZYGRO Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii GN=HOG1 PE=3 SV=1 147 415 2.0E-21
sp|A3LN91|HOG1_PICST Mitogen-activated protein kinase HOG1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HOG1 PE=3 SV=2 139 415 2.0E-21
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 149 427 2.0E-21
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 139 391 2.0E-21
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 135 432 2.0E-21
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 158 416 3.0E-21
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 158 404 3.0E-21
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 157 448 3.0E-21
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 147 415 3.0E-21
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 153 415 3.0E-21
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 160 415 3.0E-21
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 148 401 3.0E-21
sp|P38147|CHK1_YEAST Serine/threonine-protein kinase CHK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHK1 PE=1 SV=1 200 446 3.0E-21
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 158 415 3.0E-21
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 157 415 3.0E-21
sp|Q9YGW0|MKNK1_XENLA MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus laevis GN=mknk1 PE=2 SV=2 149 415 3.0E-21
sp|Q8CDB0|MKNK2_MOUSE MAP kinase-interacting serine/threonine-protein kinase 2 OS=Mus musculus GN=Mknk2 PE=1 SV=3 149 415 3.0E-21
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 144 417 3.0E-21
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 144 419 3.0E-21
sp|Q5U2N4|MKNK2_RAT MAP kinase-interacting serine/threonine-protein kinase 2 OS=Rattus norvegicus GN=Mknk2 PE=2 SV=1 149 415 4.0E-21
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 157 438 4.0E-21
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 158 415 4.0E-21
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 160 415 4.0E-21
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 152 415 4.0E-21
sp|Q7SY49|CAMKV_DANRE CaM kinase-like vesicle-associated protein OS=Danio rerio GN=camkv PE=2 SV=2 195 415 4.0E-21
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 158 404 4.0E-21
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 143 415 4.0E-21
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 159 415 4.0E-21
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 158 415 4.0E-21
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 158 415 5.0E-21
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 138 419 5.0E-21
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 158 438 5.0E-21
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 147 417 5.0E-21
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 160 415 5.0E-21
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 160 415 5.0E-21
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 180 418 5.0E-21
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 158 415 5.0E-21
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 151 415 5.0E-21
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 151 415 5.0E-21
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 149 421 5.0E-21
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 153 427 6.0E-21
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 160 415 6.0E-21
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 152 415 6.0E-21
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 147 431 6.0E-21
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 149 420 7.0E-21
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 140 415 7.0E-21
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 160 415 7.0E-21
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 206 423 7.0E-21
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 149 415 7.0E-21
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 152 416 7.0E-21
sp|Q702W0|HOG1_BLAAD Mitogen-activated protein kinase hog1 OS=Blastobotrys adeninivorans GN=hog1 PE=1 SV=1 148 415 7.0E-21
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 145 415 7.0E-21
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 158 426 7.0E-21
sp|Q9UV50|HOG1_DEBHA Mitogen-activated protein kinase HOG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HOG1 PE=1 SV=3 138 415 8.0E-21
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 158 415 8.0E-21
sp|Q8VCR8|MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus GN=Mylk2 PE=1 SV=2 108 417 8.0E-21
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 148 381 8.0E-21
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 158 403 8.0E-21
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 158 415 8.0E-21
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 147 415 8.0E-21
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 160 415 8.0E-21
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 158 426 8.0E-21
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 149 415 8.0E-21
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 133 415 8.0E-21
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 158 415 8.0E-21
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 160 415 8.0E-21
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 158 438 9.0E-21
sp|Q58D94|MKNK1_BOVIN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Bos taurus GN=MKNK1 PE=2 SV=2 149 415 9.0E-21
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 145 415 9.0E-21
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 205 450 9.0E-21
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 151 439 9.0E-21
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 158 406 1.0E-20
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 160 415 1.0E-20
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 151 354 1.0E-20
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 151 417 1.0E-20
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 147 426 1.0E-20
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 205 419 1.0E-20
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 150 415 1.0E-20
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 147 426 1.0E-20
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 137 415 1.0E-20
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 147 415 1.0E-20
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 145 415 1.0E-20
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 200 415 1.0E-20
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 160 418 1.0E-20
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 152 416 1.0E-20
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 151 417 1.0E-20
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 151 431 1.0E-20
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 152 415 1.0E-20
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 160 430 1.0E-20
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 148 415 1.0E-20
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 150 415 1.0E-20
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 148 415 1.0E-20
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 139 406 1.0E-20
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 148 415 1.0E-20
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 147 415 2.0E-20
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 158 415 2.0E-20
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 158 419 2.0E-20
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 160 453 2.0E-20
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 124 432 2.0E-20
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 137 469 2.0E-20
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 158 415 2.0E-20
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 147 426 2.0E-20
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 153 432 2.0E-20
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 158 404 2.0E-20
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 142 415 2.0E-20
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 152 415 2.0E-20
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 158 357 2.0E-20
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 204 415 2.0E-20
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 149 415 2.0E-20
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 152 415 2.0E-20
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 158 415 2.0E-20
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 137 415 2.0E-20
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 149 427 2.0E-20
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 152 414 2.0E-20
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 160 415 2.0E-20
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 158 415 2.0E-20
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 151 415 2.0E-20
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 160 420 2.0E-20
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 147 415 3.0E-20
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 158 404 6.0E-20
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 158 404 9.0E-20
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 158 406 9.0E-20
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 158 406 1.0E-19
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 158 406 1.0E-19
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 158 438 1.0E-19
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 158 404 2.0E-19
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 200 406 5.0E-19
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 158 404 7.0E-19
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 158 407 2.0E-18
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 158 404 3.0E-18
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 158 407 4.0E-18
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 158 404 2.0E-17
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 215 447 2.0E-16
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 215 447 4.0E-16
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 155 415 9.0E-15
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 231 447 3.0E-14
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 149 415 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0016310 phosphorylation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6766
MAMIVHNFTEAEMPDRYLILRDRRLARDEYERFVAVKDNSRIVLGRDAESHLILNNDPRSFVSRKHCEIYDIVYD
ESSSHVFIRDLGSHNGTWVNDAFVSRKDSRSPGFLLQDGDEIQIIPYWTLTFRDKRNFKQYTLTDLQTSEHNLFK
EKYQISQRCLGQGAEGVVCLATDVKRKKQLVCKIVNLVNYGGGADTQEQRRRKLQEADVLRQLQHPNILQYVDAL
VSPYSLYTFTELATGGDLWSYLHQHTSVGERALQFIVYQIVSALVFLHSKGVIHRDLKPENILLACSARTYSNRV
LLSDFGAYAVPRRSRMLTHAGTANYQAPEIRDASQPYTAAVDMWSLGVVALTILSHGTSFTVEGFDRMEQMHIDD
ALASLPRKVKANCKKFIGECLRVEPEKRMTAKKAWGHAWLLNPKFRRITQDMSKSRREQELQPMPCELPDLLDHH
LSAPAMEQHKARLGERLGLAEGPDAARLAWFGPGSGKLLPSEAAVLFCASPKPHPETVANCGNGGESASSISGRT
MASCQDGNIMQLTPESMSEILLDDEDAFILDSGKISQSESQPRRIGHDISETSFPLSFLDILSEDVADQSQVAIQ
NLGLRYV*
Coding >OphauB2|6766
ATGGCAATGATTGTCCACAATTTCACTGAGGCTGAAATGCCCGACCGATATCTCATCTTGCGAGATAGACGCCTG
GCCCGAGACGAGTATGAGAGGTTCGTTGCTGTCAAGGATAATAGCCGCATCGTTCTCGGCCGTGATGCAGAATCT
CACTTAATTCTCAATAACGACCCGCGAAGCTTTGTTTCCCGCAAACACTGCGAAATCTACGATATAGTATACGAC
GAGTCGAGCAGCCATGTTTTTATTCGCGACCTGGGATCCCATAACGGAACATGGGTCAATGACGCTTTTGTCAGC
AGAAAGGATTCTCGTTCTCCCGGCTTTCTTCTCCAGGATGGCGACGAGATACAAATCATTCCTTATTGGACATTG
ACCTTTCGTGACAAGCGAAACTTCAAGCAGTATACTTTGACAGATCTCCAGACGTCTGAACACAATCTTTTCAAA
GAAAAGTATCAGATATCTCAGCGCTGCCTGGGCCAAGGTGCCGAAGGTGTCGTTTGCCTGGCGACAGACGTCAAA
AGGAAGAAGCAGCTGGTCTGCAAAATTGTCAATTTAGTCAATTATGGCGGAGGCGCAGACACTCAAGAGCAGCGA
CGACGCAAGCTACAAGAAGCCGACGTGCTCCGTCAGCTCCAACATCCCAACATTCTGCAATACGTCGACGCATTG
GTGTCTCCGTACTCGTTATACACATTTACCGAATTGGCCACGGGAGGCGATCTTTGGTCATATCTGCACCAGCAT
ACCAGTGTCGGAGAACGAGCACTCCAGTTCATTGTCTACCAGATTGTTTCCGCTCTCGTATTTCTGCACTCCAAG
GGCGTGATTCATCGCGATTTGAAACCAGAAAATATCCTCTTGGCTTGCTCGGCAAGGACGTATAGTAACCGAGTG
TTGCTCTCAGACTTTGGAGCCTACGCGGTTCCTCGTCGAAGCAGAATGCTCACCCATGCTGGCACAGCCAATTAT
CAAGCTCCGGAAATCCGCGACGCTTCGCAACCTTATACGGCTGCCGTTGACATGTGGTCTCTGGGAGTTGTTGCC
CTGACGATATTGTCGCACGGCACGTCATTTACTGTTGAAGGTTTTGACCGAATGGAACAGATGCATATTGACGAC
GCTCTTGCAAGTTTGCCTCGCAAAGTCAAGGCCAACTGCAAGAAATTCATTGGGGAATGTCTTCGGGTTGAGCCG
GAAAAGCGCATGACTGCCAAGAAGGCTTGGGGCCACGCTTGGCTGCTCAACCCCAAGTTTAGGCGAATAACTCAG
GATATGTCCAAATCACGACGAGAGCAAGAGCTGCAACCCATGCCATGTGAGCTTCCCGACTTGCTGGACCATCAC
TTGTCAGCTCCAGCCATGGAGCAGCACAAGGCTCGCCTCGGAGAGAGGCTTGGTCTGGCAGAAGGGCCCGACGCA
GCAAGATTGGCGTGGTTTGGTCCAGGAAGTGGTAAGCTGCTACCTTCAGAAGCTGCTGTGCTATTCTGTGCAAGC
CCCAAGCCCCATCCGGAGACGGTGGCAAATTGTGGTAACGGGGGCGAGTCCGCTTCATCGATATCAGGGCGTACT
ATGGCTTCATGTCAAGATGGAAACATCATGCAGCTGACTCCCGAGAGCATGAGTGAAATTTTGCTCGACGACGAA
GATGCATTTATCCTCGACTCAGGCAAGATTTCTCAGTCAGAGTCCCAGCCTAGACGGATAGGACATGACATTAGC
GAAACTTCTTTTCCATTGTCTTTTCTAGATATTCTCTCGGAAGACGTCGCGGACCAGAGTCAGGTGGCCATTCAG
AACCTGGGCCTGAGATATGTCTGA
Transcript >OphauB2|6766
ATGGCAATGATTGTCCACAATTTCACTGAGGCTGAAATGCCCGACCGATATCTCATCTTGCGAGATAGACGCCTG
GCCCGAGACGAGTATGAGAGGTTCGTTGCTGTCAAGGATAATAGCCGCATCGTTCTCGGCCGTGATGCAGAATCT
CACTTAATTCTCAATAACGACCCGCGAAGCTTTGTTTCCCGCAAACACTGCGAAATCTACGATATAGTATACGAC
GAGTCGAGCAGCCATGTTTTTATTCGCGACCTGGGATCCCATAACGGAACATGGGTCAATGACGCTTTTGTCAGC
AGAAAGGATTCTCGTTCTCCCGGCTTTCTTCTCCAGGATGGCGACGAGATACAAATCATTCCTTATTGGACATTG
ACCTTTCGTGACAAGCGAAACTTCAAGCAGTATACTTTGACAGATCTCCAGACGTCTGAACACAATCTTTTCAAA
GAAAAGTATCAGATATCTCAGCGCTGCCTGGGCCAAGGTGCCGAAGGTGTCGTTTGCCTGGCGACAGACGTCAAA
AGGAAGAAGCAGCTGGTCTGCAAAATTGTCAATTTAGTCAATTATGGCGGAGGCGCAGACACTCAAGAGCAGCGA
CGACGCAAGCTACAAGAAGCCGACGTGCTCCGTCAGCTCCAACATCCCAACATTCTGCAATACGTCGACGCATTG
GTGTCTCCGTACTCGTTATACACATTTACCGAATTGGCCACGGGAGGCGATCTTTGGTCATATCTGCACCAGCAT
ACCAGTGTCGGAGAACGAGCACTCCAGTTCATTGTCTACCAGATTGTTTCCGCTCTCGTATTTCTGCACTCCAAG
GGCGTGATTCATCGCGATTTGAAACCAGAAAATATCCTCTTGGCTTGCTCGGCAAGGACGTATAGTAACCGAGTG
TTGCTCTCAGACTTTGGAGCCTACGCGGTTCCTCGTCGAAGCAGAATGCTCACCCATGCTGGCACAGCCAATTAT
CAAGCTCCGGAAATCCGCGACGCTTCGCAACCTTATACGGCTGCCGTTGACATGTGGTCTCTGGGAGTTGTTGCC
CTGACGATATTGTCGCACGGCACGTCATTTACTGTTGAAGGTTTTGACCGAATGGAACAGATGCATATTGACGAC
GCTCTTGCAAGTTTGCCTCGCAAAGTCAAGGCCAACTGCAAGAAATTCATTGGGGAATGTCTTCGGGTTGAGCCG
GAAAAGCGCATGACTGCCAAGAAGGCTTGGGGCCACGCTTGGCTGCTCAACCCCAAGTTTAGGCGAATAACTCAG
GATATGTCCAAATCACGACGAGAGCAAGAGCTGCAACCCATGCCATGTGAGCTTCCCGACTTGCTGGACCATCAC
TTGTCAGCTCCAGCCATGGAGCAGCACAAGGCTCGCCTCGGAGAGAGGCTTGGTCTGGCAGAAGGGCCCGACGCA
GCAAGATTGGCGTGGTTTGGTCCAGGAAGTGGTAAGCTGCTACCTTCAGAAGCTGCTGTGCTATTCTGTGCAAGC
CCCAAGCCCCATCCGGAGACGGTGGCAAATTGTGGTAACGGGGGCGAGTCCGCTTCATCGATATCAGGGCGTACT
ATGGCTTCATGTCAAGATGGAAACATCATGCAGCTGACTCCCGAGAGCATGAGTGAAATTTTGCTCGACGACGAA
GATGCATTTATCCTCGACTCAGGCAAGATTTCTCAGTCAGAGTCCCAGCCTAGACGGATAGGACATGACATTAGC
GAAACTTCTTTTCCATTGTCTTTTCTAGATATTCTCTCGGAAGACGTCGCGGACCAGAGTCAGGTGGCCATTCAG
AACCTGGGCCTGAGATATGTCTGA
Gene >OphauB2|6766
ATGGCAATGATTGTCCACAATTTCACTGAGGCTGAAATGCCCGACCGATATCTCATCTTGCGAGATAGACGCCTG
GCCCGAGACGAGTATGAGAGTGAGTTGCAATATTGGGTTTATTCAATTATTAGCTCGCTGACGGTCGGCCAGGGT
TCGTTGCTGTCAAGGATAATAGCCGCATCGTTCTCGGCCGTGATGCAGAATCTCAGTAAATAGTCTCGTAATTTC
TAGACTGGGAGCCGCATTCTAACTTGAAGTTTTAGCTTAATTCTCAATAACGACCCGCGAAGCTTTGTTTCCCGC
AAACACTGCGAAATCTACGATATAGTATACGACGAGTCGAGCAGCCATGTTTTTATTCGCGACCTGGGATCCCAT
AACGGAACATGGGTCAATGACGCTTTTGTCAGCAGAAAGGATTCTCGTTCTCCCGGCTTTCTTCTCCAGGATGGC
GACGAGATACAAATCATTCCTTATTGGACATTGACCTTTCGTGACAAGCGAAACTTCAAGCAGTATACTTTGACA
GATCTCCAGACGTCTGAACACAATGTACGTCTTTCATAACATCGGTTCCCATGGTGCAGTGTATGGAATACTAAT
TTGTCAATCTCGTACCAGCTTTTCAAAGAAAAGTATCAGATATCTCAGCGCTGCCTGGGCCAAGGTGCCGAAGGT
GTCGTTTGCCTGGCGACAGACGTCAAAAGGAAGAAGCAGCTGGTCTGCAAAATTGTCAATTTAGTCAATTATGGC
GGAGGCGCAGACACTCAAGAGCAGCGACGACGCAAGCTACAAGAAGCCGACGTGCTCCGTCAGCTCCAACATGTG
AGCTTCCTTGACGCATTTGTGTCTGTTGCGCGTATAGATTGCTAATCATCATAGCCCAACATTCTGCAATACGTC
GACGCATTGGTGTCTCCGTACTCGTTGTACGTACAACGTTCCTTCGCAAAAAGATTAAGCTAACATGGACAGATA
CACATTTACCGAATTGGCCACGGGAGGCGATCTTTGGTCATATCTGCACCAGCATACCAGTGTCGGAGAACGAGC
ACTCCAGTTCATTGTCTACCAGATTGTTTCCGCTCTCGTATTTCTGCACTCCAAGGGCGTGATTCATCGCGATTT
GAAACCAGAAAATATCCTCTTGGCTTGCTCGGCAAGGACGTATAGTAACCGAGTGTTGCTCTCAGACTTTGGAGC
CTACGCGGTTCCTCGTCGAAGCAGAATGCTCACCCATGCTGGCACAGCCAATTATCAAGCTCCGTGAGTCAAAAT
GTCACTGGCCCTTGCACTCGTCGCGCTAGCTAACCGTGATATTGCAGGGAAATCCGCGACGCTTCGCAACCTTAT
ACGGCTGCCGTTGACATGTGGTCTCTGGGAGTTGTTGCCCTGACGATATTGTCGCACGGCACGTCATTTACTGTT
GAAGGTTTTGACCGAATGGAACAGATGCATATTGACGACGCTCTTGCAAGTTTGCCTCGCAAAGTCAAGGCCAAC
TGCAAGAAATTCATTGGGGAATGTCTTCGGGTTGAGCCGGAAAAGCGCATGACTGCCAAGAAGGCTTGGGGCCAC
GCTTGGCTGCTCAACCCCAAGTTTAGGCGAATAACTCAGGATATGTCCAAATCACGACGAGAGCAAGAGCTGCAA
CCCATGCCATGTGAGCTTCCCGACTTGCTGGACCATCACTTGTCAGCTCCAGCCATGGAGCAGCACAAGGCTCGC
CTCGGAGAGAGGCTTGGTCTGGCAGAAGGGCCCGACGCAGCAAGATTGGCGTGGTTTGGTCCAGGAAGTGGTAAG
CTGCTACCTTCAGAAGCTGCTGTGCTATTCTGTGCAAGCCCCAAGCCCCATCCGGAGACGGTGGCAAATTGTGGT
AACGGGGGCGAGTCCGCTTCATCGATATCAGGGCGTACTATGGCTTCATGTCAAGATGGAAACATCATGCAGCTG
ACTCCCGAGAGCATGAGTGAAATTTTGCTCGACGACGAAGATGCATTTATCCTCGACTCAGGCAAGATTTCTCAG
TCAGAGTCCCAGCCTAGACGGATAGGACATGACATTAGCGAAACTTCTTTTCCATTGTCTTTTCTAGATATTCTC
TCGGAAGACGTCGCGGACCAGAGTCAGGTGGCCATTCAGAACCTGGGCCTGAGATATGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail