Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6759
Gene name
LocationContig_65:5849..6387
Strand+
Gene length (bp)538
Transcript length (bp)267
Coding sequence length (bp)267
Protein length (aa) 89

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02953 zf-Tim10_DDP Tim10/DDP family zinc finger 4.9E-20 14 76

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB65|TIM9_GIBZE Mitochondrial import inner membrane translocase subunit TIM9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM9 PE=3 SV=1 1 87 1.0E-47
sp|Q8J1Z1|TIM9_NEUCR Mitochondrial import inner membrane translocase subunit tim9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim9 PE=1 SV=1 1 87 3.0E-35
sp|Q4WIQ2|TIM9_ASPFU Mitochondrial import inner membrane translocase subunit tim9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim9 PE=3 SV=1 1 83 1.0E-28
sp|Q9Y8A7|TIM9_EMENI Mitochondrial import inner membrane translocase subunit tim9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tim9 PE=3 SV=3 1 83 7.0E-28
sp|Q6C6Z2|TIM9_YARLI Mitochondrial import inner membrane translocase subunit TIM9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM9 PE=3 SV=1 1 84 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB65|TIM9_GIBZE Mitochondrial import inner membrane translocase subunit TIM9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TIM9 PE=3 SV=1 1 87 1.0E-47
sp|Q8J1Z1|TIM9_NEUCR Mitochondrial import inner membrane translocase subunit tim9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tim9 PE=1 SV=1 1 87 3.0E-35
sp|Q4WIQ2|TIM9_ASPFU Mitochondrial import inner membrane translocase subunit tim9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tim9 PE=3 SV=1 1 83 1.0E-28
sp|Q9Y8A7|TIM9_EMENI Mitochondrial import inner membrane translocase subunit tim9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tim9 PE=3 SV=3 1 83 7.0E-28
sp|Q6C6Z2|TIM9_YARLI Mitochondrial import inner membrane translocase subunit TIM9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM9 PE=3 SV=1 1 84 2.0E-24
sp|Q6FRT3|TIM9_CANGA Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIM9 PE=3 SV=1 1 87 1.0E-22
sp|Q757S0|TIM9_ASHGO Mitochondrial import inner membrane translocase subunit TIM9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIM9 PE=3 SV=1 1 87 5.0E-22
sp|Q6BU42|TIM9_DEBHA Mitochondrial import inner membrane translocase subunit TIM9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIM9 PE=3 SV=2 1 87 8.0E-22
sp|Q6CM57|TIM9_KLULA Mitochondrial import inner membrane translocase subunit TIM9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIM9 PE=3 SV=1 1 87 9.0E-22
sp|P57745|TIM9_ZYGBA Mitochondrial import inner membrane translocase subunit Tim9 OS=Zygosaccharomyces bailii GN=TIM9 PE=3 SV=1 1 87 7.0E-21
sp|O74700|TIM9_YEAST Mitochondrial import inner membrane translocase subunit TIM9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM9 PE=1 SV=1 1 87 1.0E-20
sp|P0CR96|TIM9_CRYNJ Mitochondrial import inner membrane translocase subunit TIM9 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIM9 PE=3 SV=1 4 79 2.0E-19
sp|P0CR97|TIM9_CRYNB Mitochondrial import inner membrane translocase subunit TIM9 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIM9 PE=3 SV=1 4 79 2.0E-19
sp|Q59R24|TIM9_CANAL Mitochondrial import inner membrane translocase subunit TIM9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM9 PE=3 SV=1 1 76 5.0E-19
sp|Q9P7K0|TIM9_SCHPO Mitochondrial import inner membrane translocase subunit tim9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tim9 PE=3 SV=1 1 79 3.0E-18
sp|Q9Y5J7|TIM9_HUMAN Mitochondrial import inner membrane translocase subunit Tim9 OS=Homo sapiens GN=TIMM9 PE=1 SV=1 11 78 1.0E-14
sp|Q2KIV2|TIM9_BOVIN Mitochondrial import inner membrane translocase subunit Tim9 OS=Bos taurus GN=TIMM9 PE=3 SV=1 11 78 1.0E-14
sp|Q4V7R1|TIM9_XENLA Mitochondrial import inner membrane translocase subunit Tim9 OS=Xenopus laevis GN=timm9 PE=3 SV=1 11 78 2.0E-14
sp|Q9WV98|TIM9_MOUSE Mitochondrial import inner membrane translocase subunit Tim9 OS=Mus musculus GN=Timm9 PE=1 SV=1 11 78 3.0E-14
sp|Q9W762|TIM9_DANRE Mitochondrial import inner membrane translocase subunit Tim9 OS=Danio rerio GN=timm9 PE=3 SV=2 11 78 3.0E-14
sp|Q9WV97|TIM9_RAT Mitochondrial import inner membrane translocase subunit Tim9 OS=Rattus norvegicus GN=Timm9 PE=1 SV=3 11 78 3.0E-14
sp|Q5ZIR8|TIM9_CHICK Mitochondrial import inner membrane translocase subunit Tim9 OS=Gallus gallus GN=TIMM9 PE=3 SV=1 11 78 1.0E-13
sp|Q61TH2|TIM9_CAEBR Mitochondrial import inner membrane translocase subunit Tim9 OS=Caenorhabditis briggsae GN=tin-9.1 PE=3 SV=1 13 77 6.0E-12
sp|Q17754|TIM9_CAEEL Mitochondrial import inner membrane translocase subunit Tim9 OS=Caenorhabditis elegans GN=tin-9.1 PE=3 SV=1 13 77 1.0E-11
sp|Q9XGX8|TIM9_MESCR Mitochondrial import inner membrane translocase subunit Tim9 OS=Mesembryanthemum crystallinum GN=TIM9 PE=3 SV=1 1 78 2.0E-11
sp|Q9VYD7|TIM9_DROME Mitochondrial import inner membrane translocase subunit Tim9 OS=Drosophila melanogaster GN=Tim9a PE=3 SV=1 3 76 3.0E-11
sp|Q9XGX7|TIM9_ORYSJ Mitochondrial import inner membrane translocase subunit Tim9 OS=Oryza sativa subsp. japonica GN=TIM9 PE=3 SV=2 1 82 4.0E-11
sp|Q9XGX9|TIM9_ARATH Mitochondrial import inner membrane translocase subunit TIM9 OS=Arabidopsis thaliana GN=TIM9 PE=1 SV=2 1 84 6.0E-11
sp|Q9Y0V2|T10B_CAEEL Mitochondrial import inner membrane translocase subunit Tim10B OS=Caenorhabditis elegans GN=tin-9.2 PE=3 SV=1 20 77 4.0E-07
sp|Q9Y0V3|T10B_DROME Mitochondrial import inner membrane translocase subunit Tim10B OS=Drosophila melanogaster GN=Tim9b PE=3 SV=1 19 84 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4495
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3832
Ophiocordyceps australis map64 (Brazil) OphauB2|6759 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01273
Ophiocordyceps camponoti-rufipedis Ophun1|794
Ophiocordyceps kimflemingae Ophio5|1047
Ophiocordyceps subramaniannii Hirsu2|9375

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6759
MDMLTTAEQRQLEQRMQKRQVKEFMGAFSGLVEHCFTSCVDDFTSKALSSRENGCMQRCVQKWMATQQRVSERFQ
EHNATVTQQMSKN*
Coding >OphauB2|6759
ATGGACATGCTCACCACCGCCGAGCAGCGCCAGCTCGAGCAGCGCATGCAGAAGCGCCAAGTCAAGGAATTCATG
GGCGCTTTCAGTGGCCTCGTCGAACACTGCTTCACTAGCTGCGTCGACGACTTCACTTCAAAGGCCCTTTCCTCG
CGCGAAAATGGATGCATGCAGCGCTGCGTGCAGAAATGGATGGCCACACAACAGCGAGTTAGCGAACGATTCCAA
GAACACAACGCCACAGTCACCCAACAGATGTCCAAGAACTGA
Transcript >OphauB2|6759
ATGGACATGCTCACCACCGCCGAGCAGCGCCAGCTCGAGCAGCGCATGCAGAAGCGCCAAGTCAAGGAATTCATG
GGCGCTTTCAGTGGCCTCGTCGAACACTGCTTCACTAGCTGCGTCGACGACTTCACTTCAAAGGCCCTTTCCTCG
CGCGAAAATGGATGCATGCAGCGCTGCGTGCAGAAATGGATGGCCACACAACAGCGAGTTAGCGAACGATTCCAA
GAACACAACGCCACAGTCACCCAACAGATGTCCAAGAACTGA
Gene >OphauB2|6759
ATGGACATGTAAAGTCTTTTTCACGTCAATTCTGATGCAAATTTGACCCGCTAACCCTTTGCGCAGGCTCACCAC
CGCCGAGCAGCGCCAGCTCGAGCAGCGCATGCAGAAGCGCCAAGTCAAGGAATTCATGGGCGTACGTCTTCTTCC
TCGCCTGTCTCCTTGCCCAGCTCGTACAGCTCCCGCCCTGCACTAAATCATCATTTCCTCTTCGAGCCTCAAGCA
ATGCCGGTGCATACATGAGGGATTTGGAAAAAGCTTGCGTCTTGCCCGCATTACACCAAGGATCCATGACAAGCA
CAAAAAAGGCAACCAGTCAATAAACTCCTGATCCGCTTACACTCTCTAGGCTTTCAGTGGCCTCGTCGAACACTG
CTTCACTAGCTGCGTCGACGACTTCACTTCAAAGGCCCTTTCCTCGCGCGAAAATGGATGCATGCAGCGCTGCGT
GCAGAAATGGATGGCCACACAACAGCGAGTTAGCGAACGATTCCAAGAACACAACGCCACAGTCACCCAACAGAT
GTCCAAGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail