Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6752
Gene name
LocationContig_64:95497..96418
Strand+
Gene length (bp)921
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03357 Snf7 Snf7 6.4E-34 14 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZL55|CHMP6_CHICK Charged multivesicular body protein 6 OS=Gallus gallus GN=CHMP6 PE=2 SV=3 6 165 3.0E-42
sp|Q96FZ7|CHMP6_HUMAN Charged multivesicular body protein 6 OS=Homo sapiens GN=CHMP6 PE=1 SV=3 6 178 1.0E-39
sp|Q5R861|CHMP6_PONAB Charged multivesicular body protein 6 OS=Pongo abelii GN=CHMP6 PE=2 SV=3 6 178 1.0E-39
sp|Q503V0|CHMP6_DANRE Charged multivesicular body protein 6 OS=Danio rerio GN=chmp6 PE=2 SV=3 6 193 3.0E-39
sp|P0C0A3|CHMP6_MOUSE Charged multivesicular body protein 6 OS=Mus musculus GN=Chmp6 PE=1 SV=2 6 178 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZL55|CHMP6_CHICK Charged multivesicular body protein 6 OS=Gallus gallus GN=CHMP6 PE=2 SV=3 6 165 3.0E-42
sp|Q96FZ7|CHMP6_HUMAN Charged multivesicular body protein 6 OS=Homo sapiens GN=CHMP6 PE=1 SV=3 6 178 1.0E-39
sp|Q5R861|CHMP6_PONAB Charged multivesicular body protein 6 OS=Pongo abelii GN=CHMP6 PE=2 SV=3 6 178 1.0E-39
sp|Q503V0|CHMP6_DANRE Charged multivesicular body protein 6 OS=Danio rerio GN=chmp6 PE=2 SV=3 6 193 3.0E-39
sp|P0C0A3|CHMP6_MOUSE Charged multivesicular body protein 6 OS=Mus musculus GN=Chmp6 PE=1 SV=2 6 178 3.0E-38
sp|Q54KZ4|CHMP6_DICDI Charged multivesicular body protein 6 OS=Dictyostelium discoideum GN=chmp6 PE=3 SV=2 7 181 5.0E-35
sp|O94318|VPS20_SCHPO Vacuolar protein sorting-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps20 PE=3 SV=1 1 187 5.0E-35
sp|Q6GMA4|CHM6A_XENLA Charged multivesicular body protein 6-A OS=Xenopus laevis GN=chmp6-a PE=2 SV=3 6 145 2.0E-31
sp|Q6NU11|CHM6B_XENLA Charged multivesicular body protein 6-B OS=Xenopus laevis GN=chmp6-b PE=2 SV=3 6 145 3.0E-31
sp|Q9FY89|VP202_ARATH Vacuolar protein sorting-associated protein 20 homolog 2 OS=Arabidopsis thaliana GN=VPS20.2 PE=1 SV=1 7 190 2.0E-28
sp|Q8GXN6|VP201_ARATH Vacuolar protein sorting-associated protein 20 homolog 1 OS=Arabidopsis thaliana GN=VPS20.1 PE=1 SV=1 8 183 6.0E-28
sp|Q04272|VPS20_YEAST Vacuolar protein sorting-associated protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS20 PE=1 SV=3 1 183 3.0E-20
sp|Q6FW96|SNF7_CANGA Vacuolar-sorting protein SNF7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF7 PE=3 SV=1 3 177 1.0E-09
sp|Q753W3|SNF7_ASHGO Vacuolar-sorting protein SNF7 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SNF7 PE=3 SV=1 13 138 2.0E-08
sp|Q6BSH2|SNF7_DEBHA Vacuolar-sorting protein SNF7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNF7 PE=3 SV=2 1 189 9.0E-08
sp|P39929|SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF7 PE=1 SV=1 13 141 3.0E-07
sp|Q5ABD0|SNF7_CANAL Vacuolar-sorting protein SNF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SNF7 PE=3 SV=1 1 147 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0007034 vacuolar transport Yes
GO:0046907 intracellular transport No
GO:0009987 cellular process No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6752
MGGNTSKVTAQDKAILDMKNQRDKLHQYQRRISVLTDKETDIARQMLARGDKKRALLALRRKKYQESLLSKTDAQ
LEQLEKLTANVEFARIQKDVVFGLAQGTRVLKEIHAEMGGIEHVEKLMGETADAIAYQKEVSDLLGGRISNQDEE
EVEDELAALQAELADPHQLPSVPNAHVPKAQRLAQESPERQQESNRQAMLAS*
Coding >OphauB2|6752
ATGGGAGGCAACACGAGCAAAGTGACTGCCCAAGACAAGGCAATTCTCGACATGAAGAACCAGCGCGACAAACTC
CACCAATACCAGCGCCGCATCAGCGTCCTAACAGACAAGGAGACGGACATTGCGCGGCAAATGCTTGCGCGCGGC
GACAAGAAGCGCGCACTCTTGGCGCTGCGGCGCAAAAAATACCAGGAAAGCTTGCTGAGCAAGACGGATGCGCAG
CTGGAGCAGCTGGAGAAGCTGACGGCAAATGTCGAGTTTGCGCGGATACAAAAGGACGTGGTATTTGGGCTGGCG
CAGGGGACGCGCGTGCTAAAGGAGATTCATGCTGAAATGGGAGGCATTGAGCATGTTGAGAAGCTCATGGGCGAA
ACGGCAGATGCCATTGCCTATCAAAAGGAAGTAAGCGACCTCCTCGGCGGCCGCATCTCCAACCAAGACGAAGAA
GAAGTCGAAGACGAACTCGCCGCCCTGCAAGCCGAACTCGCCGACCCGCACCAACTCCCCTCGGTGCCCAACGCC
CACGTCCCCAAGGCCCAGCGCCTCGCACAAGAGTCGCCCGAGCGGCAACAAGAATCGAATAGACAAGCAATGCTT
GCGTCGTGA
Transcript >OphauB2|6752
ATGGGAGGCAACACGAGCAAAGTGACTGCCCAAGACAAGGCAATTCTCGACATGAAGAACCAGCGCGACAAACTC
CACCAATACCAGCGCCGCATCAGCGTCCTAACAGACAAGGAGACGGACATTGCGCGGCAAATGCTTGCGCGCGGC
GACAAGAAGCGCGCACTCTTGGCGCTGCGGCGCAAAAAATACCAGGAAAGCTTGCTGAGCAAGACGGATGCGCAG
CTGGAGCAGCTGGAGAAGCTGACGGCAAATGTCGAGTTTGCGCGGATACAAAAGGACGTGGTATTTGGGCTGGCG
CAGGGGACGCGCGTGCTAAAGGAGATTCATGCTGAAATGGGAGGCATTGAGCATGTTGAGAAGCTCATGGGCGAA
ACGGCAGATGCCATTGCCTATCAAAAGGAAGTAAGCGACCTCCTCGGCGGCCGCATCTCCAACCAAGACGAAGAA
GAAGTCGAAGACGAACTCGCCGCCCTGCAAGCCGAACTCGCCGACCCGCACCAACTCCCCTCGGTGCCCAACGCC
CACGTCCCCAAGGCCCAGCGCCTCGCACAAGAGTCGCCCGAGCGGCAACAAGAATCGAATAGACAAGCAATGCTT
GCGTCGTGA
Gene >OphauB2|6752
ATGGGAGGCAACACGAGCAAAGTGACTGCCCAAGACAAGTTCGCAAACCCCCCCCTCTCCCTCCTCTCCTCGAAA
GAAAGCAAACCACAAAACTATTATCAAGCAAAGAAGACAAACTCCCCCCAAAACCCCAAAAAATCCTAGTTTCCA
CGAATAAAGCAACCAAGATGCCAAGACCCCCAGCACTAACGGCGTGGCCACCATCAGGGCAATTCTCGACATGAA
GAACCAGCGCGACAAACTCCACCAATACCAGCGCCGCATCAGCGTCCTAACAGACAAGGAGACGGACATTGCGCG
GCAAATGCTTGCGCGCGGCGACAAGAAGCGCGCACTCTTGGCGCTGCGGCGCAAAAAATACCAGGAAAGCTTGCT
GAGCAAGACGGATGCGCAGCTGGAGCAGCTGGAGAAGCTGACGGCAAATGTCGAGTTTGCGCGGATACAAAAGGA
CGTGGTATTTGGGCTGGCGCAGGGGACGCGCGTGCTAAAGGAGATTCATGCTGAAATGGGAGGCATTGAGCATGT
TGAGAAGCTCATGGGCGAAACGGCAGATGCCATTGCCTATCAAAAGGTGAGGCGGCCCTCTTTTTTCTCTTGTGT
ATTTTTCTTTTTATTCTGACCTTTATTACATCTGTCATTTCTTCTGGCTTCTCTTGTCGACTTCTTTTCTTGACT
TGTTCTGGCTTCTCTTCTGACGCTTTTTTTTTTTTGCAGGAAGTAAGCGACCTCCTCGGCGGCCGCATCTCCAAC
CAAGACGAAGAAGAAGTCGAAGACGAACTCGCCGCCCTGCAAGCCGAACTCGCCGACCCGCACCAACTCCCCTCG
GTGCCCAACGCCCACGTCCCCAAGGCCCAGCGCCTCGCACAAGAGTCGCCCGAGCGGCAACAAGAATCGAATAGA
CAAGCAATGCTTGCGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail