Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6750
Gene name
LocationContig_64:91396..92062
Strand+
Gene length (bp)666
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00034 Cytochrom_C Cytochrome c 1.8E-11 6 103
PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III 4.0E-08 5 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00048|CYC_NEUCR Cytochrome c OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyc-1 PE=1 SV=2 1 106 2.0E-61
sp|Q4HVX7|CYC_GIBZE Cytochrome c OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYC1 PE=3 SV=2 1 105 1.0E-60
sp|P00047|CYC_THELA Cytochrome c OS=Thermomyces lanuginosus PE=1 SV=1 4 105 1.0E-59
sp|P59218|CYC_ROSNE Cytochrome c OS=Rosellinia necatrix GN=CYTC PE=3 SV=1 1 106 5.0E-59
sp|P29380|CYC_ARATH Cytochrome c OS=Arabidopsis thaliana GN=CC-1 PE=3 SV=1 4 105 1.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00048|CYC_NEUCR Cytochrome c OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyc-1 PE=1 SV=2 1 106 2.0E-61
sp|Q4HVX7|CYC_GIBZE Cytochrome c OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYC1 PE=3 SV=2 1 105 1.0E-60
sp|P00047|CYC_THELA Cytochrome c OS=Thermomyces lanuginosus PE=1 SV=1 4 105 1.0E-59
sp|P59218|CYC_ROSNE Cytochrome c OS=Rosellinia necatrix GN=CYTC PE=3 SV=1 1 106 5.0E-59
sp|P29380|CYC_ARATH Cytochrome c OS=Arabidopsis thaliana GN=CC-1 PE=3 SV=1 4 105 1.0E-57
sp|Q96VP3|CYC_COCLU Cytochrome c OS=Cochliobolus lunatus PE=3 SV=1 4 105 1.0E-56
sp|P56205|CYC_ASPNG Cytochrome c OS=Aspergillus niger GN=cycA PE=1 SV=1 1 106 5.0E-56
sp|Q41346|CYC_STELP Cytochrome c OS=Stellaria longipes PE=3 SV=1 4 105 1.0E-55
sp|P38091|CYC_EMENI Cytochrome c OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cycA PE=2 SV=3 4 106 2.0E-54
sp|P00046|CYC_SCHPO Cytochrome c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyc1 PE=1 SV=3 2 106 3.0E-53
sp|P00049|CYC_USTSP Cytochrome c OS=Ustilago sphaerogena PE=1 SV=1 4 105 8.0E-53
sp|P00039|CYC_MANSE Cytochrome c OS=Manduca sexta PE=1 SV=2 1 105 2.0E-50
sp|P53698|CYC_CANAL Cytochrome c OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYC1 PE=3 SV=3 4 106 3.0E-50
sp|Q6Q4H8|CYC_PICPA Cytochrome c OS=Komagataella pastoris GN=CYC1 PE=3 SV=3 4 105 4.0E-50
sp|P00040|CYC_SCHGR Cytochrome c OS=Schistocerca gregaria PE=1 SV=2 4 105 4.0E-50
sp|P25400|CYC_CANGA Cytochrome c OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CYC1 PE=3 SV=1 7 106 7.0E-50
sp|P12831|CYC_SARPE Cytochrome c OS=Sarcophaga peregrina PE=1 SV=2 1 105 7.0E-50
sp|P84029|CYC2_DROME Cytochrome c-2 OS=Drosophila melanogaster GN=Cyt-c-p PE=1 SV=2 1 105 3.0E-49
sp|P84030|CYC2_CERCA Cytochrome c-2 OS=Ceratitis capitata PE=1 SV=2 1 105 3.0E-49
sp|P00036|CYC_LUCCU Cytochrome c OS=Lucilia cuprina PE=1 SV=2 1 105 5.0E-49
sp|P00035|CYC_HAEIR Cytochrome c OS=Haematobia irritans PE=1 SV=2 1 105 6.0E-49
sp|P00020|CYC_ANAPL Cytochrome c OS=Anas platyrhynchos GN=CYC PE=1 SV=2 4 106 8.0E-49
sp|Q6DKE1|CYC2_XENLA Cytochrome c, testis-specific OS=Xenopus laevis GN=cyct PE=3 SV=3 4 106 1.0E-48
sp|O93863|CYC_PACTA Cytochrome c OS=Pachysolen tannophilus GN=CYC1 PE=3 SV=3 4 105 1.0E-48
sp|P00021|CYC_COLLI Cytochrome c OS=Columba livia GN=CYC PE=1 SV=2 4 106 1.0E-48
sp|P00041|CYC_PICKU Cytochrome c OS=Pichia kudriavzevii GN=CYC1 PE=1 SV=1 4 105 1.0E-48
sp|P00045|CYC7_YEAST Cytochrome c iso-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC7 PE=1 SV=1 4 104 2.0E-48
sp|P67882|CYC_MELGA Cytochrome c OS=Meleagris gallopavo GN=CYC PE=1 SV=2 4 106 3.0E-48
sp|P67881|CYC_CHICK Cytochrome c OS=Gallus gallus GN=CYC PE=1 SV=2 4 106 3.0E-48
sp|P21665|CYC_VARVA Cytochrome c OS=Varanus varius PE=1 SV=2 4 106 6.0E-48
sp|O13393|CYC_PICST Cytochrome c OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CYC1 PE=3 SV=3 4 105 6.0E-48
sp|P19681|CYC_SCHOC Cytochrome c OS=Schwanniomyces occidentalis GN=CYC1 PE=3 SV=2 4 105 6.0E-48
sp|P00017|CYC_APTPA Cytochrome c OS=Aptenodytes patagonicus GN=CYC PE=1 SV=2 4 106 6.0E-48
sp|P00042|CYC_WICAO Cytochrome c OS=Wickerhamomyces anomalus PE=1 SV=1 4 105 8.0E-48
sp|Q6PBF4|CYC2_XENTR Cytochrome c, testis-specific OS=Xenopus tropicalis GN=cyct PE=3 SV=3 4 106 1.0E-47
sp|P00044|CYC1_YEAST Cytochrome c iso-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC1 PE=1 SV=2 4 104 1.0E-47
sp|P00018|CYC_DRONO Cytochrome c OS=Dromaius novaehollandiae GN=CYC PE=1 SV=2 4 106 3.0E-47
sp|Q6QLW4|CYC_PECGU Cytochrome c OS=Pectinaria gouldii PE=3 SV=1 1 105 3.0E-47
sp|P00068|CYC_WHEAT Cytochrome c OS=Triticum aestivum PE=1 SV=1 4 106 4.0E-47
sp|P00037|CYC_SAMCY Cytochrome c OS=Samia cynthia PE=1 SV=2 1 105 5.0E-47
sp|P68096|CYC_EQUBU Cytochrome c OS=Equus burchelli GN=CYCS PE=1 SV=2 4 105 5.0E-47
sp|P68097|CYC_EQUAS Cytochrome c OS=Equus asinus GN=CYCS PE=1 SV=2 4 105 5.0E-47
sp|P00043|CYC_DEBHA Cytochrome c OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CYC1 PE=1 SV=3 4 105 6.0E-47
sp|P00019|CYC_STRCA Cytochrome c OS=Struthio camelus GN=CYC PE=1 SV=2 4 106 6.0E-47
sp|P00008|CYC_RABIT Cytochrome c OS=Oryctolagus cuniculus GN=CYCS PE=1 SV=2 4 105 1.0E-46
sp|P00004|CYC_HORSE Cytochrome c OS=Equus caballus GN=CYCS PE=1 SV=2 4 105 2.0E-46
sp|P62898|CYC_RAT Cytochrome c, somatic OS=Rattus norvegicus GN=Cycs PE=1 SV=2 4 105 2.0E-46
sp|P62897|CYC_MOUSE Cytochrome c, somatic OS=Mus musculus GN=Cycs PE=1 SV=2 4 105 2.0E-46
sp|O23138|CYC1_ARATH Cytochrome c-1 OS=Arabidopsis thaliana GN=CYTC-1 PE=1 SV=1 4 106 2.0E-46
sp|Q6C9Q0|CYC_YARLI Cytochrome c OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CYC1 PE=3 SV=1 4 103 2.0E-46
sp|P62896|CYC_SHEEP Cytochrome c OS=Ovis aries GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|P62895|CYC_PIG Cytochrome c OS=Sus scrofa GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|Q52V08|CYC_MACSY Cytochrome c OS=Macaca sylvanus GN=CYCS PE=3 SV=3 4 105 4.0E-46
sp|P00002|CYC_MACMU Cytochrome c OS=Macaca mulatta GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|P62894|CYC_BOVIN Cytochrome c OS=Bos taurus GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|Q6IQM2|CYC_DANRE Cytochrome c OS=Danio rerio GN=cyc PE=3 SV=3 4 106 4.0E-46
sp|P00025|CYC_KATPE Cytochrome c OS=Katsuwonus pelamis GN=cyc PE=1 SV=2 4 106 4.0E-46
sp|O22642|CYC_FRIAG Cytochrome c OS=Fritillaria agrestis GN=CYTC PE=3 SV=3 4 106 4.0E-46
sp|P00007|CYC_HIPAM Cytochrome c OS=Hippopotamus amphibius GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|P00051|CYC_CUCMA Cytochrome c OS=Cucurbita maxima PE=1 SV=1 4 106 6.0E-46
sp|P81459|CYC_THUAA Cytochrome c OS=Thunnus alalunga GN=cyc PE=1 SV=1 4 106 6.0E-46
sp|P62773|CYC_BRAOL Cytochrome c OS=Brassica oleracea PE=1 SV=1 4 106 6.0E-46
sp|P62772|CYC_BRANA Cytochrome c OS=Brassica napus PE=1 SV=1 4 106 6.0E-46
sp|P32556|CYC_KLULA Cytochrome c OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CYCK PE=3 SV=1 4 104 6.0E-46
sp|P00011|CYC_CANLF Cytochrome c OS=Canis lupus familiaris GN=CYCS PE=1 SV=2 4 105 7.0E-46
sp|P00013|CYC_MINSC Cytochrome c OS=Miniopterus schreibersii GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P00038|CYC_APIME Cytochrome c OS=Apis mellifera GN=cytC PE=1 SV=2 1 105 8.0E-46
sp|P68098|CYC_LAMGU Cytochrome c OS=Lama guanicoe GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P68100|CYC_ESCRO Cytochrome c OS=Eschrichtius robustus GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P68099|CYC_CAMDR Cytochrome c OS=Camelus dromedarius GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P00027|CYC_SQUSU Cytochrome c OS=Squalus suckleyi GN=cyc PE=1 SV=2 4 106 1.0E-45
sp|P81280|CYC_ALLMI Cytochrome c OS=Alligator mississippiensis PE=1 SV=2 4 106 1.0E-45
sp|P00059|CYC_ABUTH Cytochrome c OS=Abutilon theophrasti PE=1 SV=1 4 106 1.0E-45
sp|P68519|CYC_CROVV Cytochrome c OS=Crotalus viridis viridis PE=1 SV=2 4 106 1.0E-45
sp|P68518|CYC_CROAT Cytochrome c OS=Crotalus atrox PE=1 SV=2 4 106 1.0E-45
sp|P68517|CYC_CROAD Cytochrome c OS=Crotalus adamanteus PE=1 SV=2 4 106 1.0E-45
sp|P00069|CYC_GUIAB Cytochrome c OS=Guizotia abyssinica PE=1 SV=1 4 106 1.0E-45
sp|P00012|CYC_MIRLE Cytochrome c OS=Mirounga leonina GN=CYCS PE=1 SV=2 4 105 2.0E-45
sp|Q5RFH4|CYC_PONAB Cytochrome c OS=Pongo abelii GN=CYCS PE=3 SV=3 4 105 2.0E-45
sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN=CYCS PE=1 SV=2 4 105 2.0E-45
sp|P99999|CYC_HUMAN Cytochrome c OS=Homo sapiens GN=CYCS PE=1 SV=2 4 105 2.0E-45
sp|Q6WUX8|CYC_GORGO Cytochrome c OS=Gorilla gorilla gorilla GN=CYCS PE=3 SV=3 4 105 2.0E-45
sp|P00064|CYC_ALLPO Cytochrome c OS=Allium porrum PE=1 SV=1 4 106 2.0E-45
sp|Q4SG99|CYC_TETNG Cytochrome c OS=Tetraodon nigroviridis GN=cyc PE=3 SV=1 4 106 2.0E-45
sp|P00052|CYC_VIGRR Cytochrome c OS=Vigna radiata var. radiata PE=1 SV=1 4 106 2.0E-45
sp|P00066|CYC_NIGDA Cytochrome c OS=Nigella damascena PE=1 SV=1 4 106 3.0E-45
sp|P00057|CYC_RICCO Cytochrome c OS=Ricinus communis PE=1 SV=1 4 106 3.0E-45
sp|P00056|CYC_MAIZE Cytochrome c OS=Zea mays PE=1 SV=1 4 106 3.0E-45
sp|Q52V09|CYC_TARBA Cytochrome c OS=Tarsius bancanus GN=CYCS PE=3 SV=3 4 105 3.0E-45
sp|P00028|CYC_LAMTR Cytochrome c OS=Lampetra tridentata GN=cyc PE=1 SV=2 4 106 4.0E-45
sp|P00026|CYC_CYPCA Cytochrome c iso-1/iso-2 OS=Cyprinus carpio GN=cyc PE=1 SV=3 4 106 4.0E-45
sp|P00072|CYC_FAGES Cytochrome c OS=Fagopyrum esculentum PE=1 SV=1 4 105 4.0E-45
sp|P00022|CYC_CHESE Cytochrome c OS=Chelydra serpentina PE=1 SV=2 4 106 5.0E-45
sp|P00003|CYC_ATESP Cytochrome c OS=Ateles sp. GN=CYCS PE=1 SV=3 4 105 6.0E-45
sp|Q6GQE4|CYC1A_XENLA Cytochrome c, somatic A OS=Xenopus laevis GN=cycs-a PE=3 SV=3 4 106 6.0E-45
sp|P00058|CYC_GOSBA Cytochrome c OS=Gossypium barbadense PE=1 SV=1 4 106 7.0E-45
sp|P00061|CYC_SOLTU Cytochrome c OS=Solanum tuberosum PE=1 SV=1 4 106 7.0E-45
sp|Q9T0G2|CYC2_ARATH Cytochrome c-2 OS=Arabidopsis thaliana GN=CYTC-2 PE=1 SV=1 4 106 7.0E-45
sp|P00029|CYC_ASTRU Cytochrome c OS=Asterias rubens PE=1 SV=2 4 105 9.0E-45
sp|Q1KKS2|CYCB_TAKRU Cytochrome c-b OS=Takifugu rubripes GN=cyc-B PE=3 SV=1 4 106 9.0E-45
sp|P00062|CYC_SAMNI Cytochrome c OS=Sambucus nigra PE=1 SV=1 4 106 1.0E-44
sp|Q0DI31|CYC_ORYSJ Cytochrome c OS=Oryza sativa subsp. japonica GN=CC-1 PE=1 SV=1 4 106 1.0E-44
sp|A2Y4S9|CYC_ORYSI Cytochrome c OS=Oryza sativa subsp. indica GN=CC-1 PE=3 SV=1 4 106 1.0E-44
sp|P00031|CYC_MACMA Cytochrome c OS=Macrobrachium malcolmsonii PE=1 SV=2 4 105 1.0E-44
sp|Q640U4|CYC1_XENTR Cytochrome c, somatic OS=Xenopus tropicalis GN=cycs PE=3 SV=3 4 106 1.0E-44
sp|P00067|CYC_TROMA Cytochrome c OS=Tropaeolum majus PE=1 SV=1 4 106 1.0E-44
sp|P00030|CYC_EISFE Cytochrome c OS=Eisenia fetida PE=1 SV=1 1 105 1.0E-44
sp|P10715|CYC2_RAT Cytochrome c, testis-specific OS=Rattus norvegicus GN=Cyct PE=2 SV=2 4 106 2.0E-44
sp|P00054|CYC_SESIN Cytochrome c OS=Sesamum indicum PE=1 SV=1 4 106 2.0E-44
sp|Q52V10|CYC_SAISC Cytochrome c OS=Saimiri sciureus GN=CYCS PE=3 SV=3 4 105 2.0E-44
sp|P00024|CYC_LITCT Cytochrome c OS=Lithobates catesbeiana PE=1 SV=2 4 106 2.0E-44
sp|P00060|CYC_SOLLC Cytochrome c OS=Solanum lycopersicum PE=1 SV=2 4 106 2.0E-44
sp|P00074|CYC_GINBI Cytochrome c OS=Ginkgo biloba PE=1 SV=1 4 106 2.0E-44
sp|Q7YR71|CYC_TRACR Cytochrome c OS=Trachypithecus cristatus GN=CYCS PE=3 SV=3 4 105 3.0E-44
sp|P00053|CYC_CANSA Cytochrome c OS=Cannabis sativa PE=1 SV=1 4 106 3.0E-44
sp|P00071|CYC_PASSA Cytochrome c OS=Pastinaca sativa PE=1 SV=1 4 106 4.0E-44
sp|P00015|CYC2_MOUSE Cytochrome c, testis-specific OS=Mus musculus GN=Cyct PE=1 SV=3 4 106 4.0E-44
sp|P00073|CYC_SPIOL Cytochrome c OS=Spinacia oleracea PE=1 SV=1 4 105 4.0E-44
sp|Q1KL06|CYCA_TAKRU Cytochrome c-a OS=Takifugu rubripes GN=cyc-a PE=3 SV=1 4 106 4.0E-44
sp|B4USV4|CYC_OTOGA Cytochrome c OS=Otolemur garnettii GN=CYCS PE=3 SV=1 5 105 5.0E-44
sp|P00014|CYC_MACGI Cytochrome c OS=Macropus giganteus GN=CYCS PE=1 SV=2 4 105 5.0E-44
sp|P00070|CYC_HELAN Cytochrome c OS=Helianthus annuus GN=CYTC1 PE=1 SV=3 4 106 8.0E-44
sp|P00065|CYC_ARUMA Cytochrome c OS=Arum maculatum PE=1 SV=1 4 106 9.0E-44
sp|Q753F4|CYC_ASHGO Cytochrome c OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CYC1 PE=3 SV=2 4 104 1.0E-43
sp|P00032|CYC_HELAS Cytochrome c OS=Helix aspersa PE=1 SV=1 4 105 3.0E-43
sp|Q6NTN0|CYC1B_XENLA Cytochrome c, somatic B OS=Xenopus laevis GN=cycs-b PE=3 SV=3 4 106 5.0E-43
sp|P00075|CYC_ULVIN Cytochrome c OS=Ulva intestinalis PE=1 SV=1 4 106 5.0E-43
sp|Q3SZT9|CYC2_BOVIN Cytochrome c 2 OS=Bos taurus GN=CYCT PE=3 SV=3 5 106 1.0E-42
sp|P00063|CYC_ACENE Cytochrome c OS=Acer negundo PE=1 SV=1 4 106 5.0E-42
sp|Q4N594|CYC_THEPA Cytochrome c OS=Theileria parva GN=TP02_0396 PE=3 SV=1 4 106 9.0E-42
sp|Q4UEA0|CYC_THEAN Cytochrome c OS=Theileria annulata GN=TA12950 PE=3 SV=1 4 106 1.0E-41
sp|P15451|CYC_CHLRE Cytochrome c OS=Chlamydomonas reinhardtii GN=CYC1 PE=3 SV=2 4 106 5.0E-40
sp|P00076|CYC_EUGGR Cytochrome c OS=Euglena gracilis PE=1 SV=1 4 102 3.0E-39
sp|Q869N1|CYC_DICDI Cytochrome c OS=Dictyostelium discoideum GN=cytC PE=3 SV=1 1 105 7.0E-38
sp|P00078|CYC_CRIFA Cytochrome c OS=Crithidia fasciculata PE=1 SV=2 1 102 9.0E-38
sp|P22342|CYC_EUGVI Cytochrome c OS=Euglena viridis PE=1 SV=1 4 102 1.0E-37
sp|P04657|CYC1_DROME Cytochrome c-1 OS=Drosophila melanogaster GN=Cyt-c-d PE=2 SV=2 1 102 2.0E-37
sp|P92504|CYC1_ASCSU Cytochrome c type-1 OS=Ascaris suum PE=1 SV=3 1 103 2.0E-37
sp|P19974|CYC21_CAEEL Cytochrome c 2.1 OS=Caenorhabditis elegans GN=cyc-2.1 PE=1 SV=2 1 106 4.0E-37
sp|A8WQY3|CYC21_CAEBR Cytochrome c 2.1 OS=Caenorhabditis briggsae GN=cyc-2.1 PE=3 SV=1 1 102 1.0E-35
sp|Q23240|CYC22_CAEEL Probable cytochrome c 2.2 OS=Caenorhabditis elegans GN=cyc-2.2 PE=3 SV=1 4 106 3.0E-35
sp|P00077|CYC_STROO Cytochrome c OS=Strigomonas oncopelti PE=1 SV=2 1 102 2.0E-34
sp|P92505|CYC2_ASCSU Cytochrome c type-2 OS=Ascaris suum PE=2 SV=3 4 102 3.0E-34
sp|A8X769|CYC22_CAEBR Probable cytochrome c 2.2 OS=Caenorhabditis briggsae GN=cyc-2.2 PE=3 SV=2 4 102 3.0E-32
sp|P00083|CYC2_BLAVI Cytochrome c2 OS=Blastochloris viridis GN=cycA PE=1 SV=2 9 106 8.0E-32
sp|P86322|CYC21_RHOCR Cytochrome c2 OS=Rhodoplanes cryptolactis PE=1 SV=1 5 103 4.0E-31
sp|P00082|CYC2_RHOVT Cytochrome c2 OS=Rhodomicrobium vannielii (strain ATCC 17100 / ATH 3.1.1 / DSM 162 / LMG 4299) GN=Rvan_1007 PE=1 SV=2 2 101 4.0E-28
sp|P00079|CYC_TETPY Cytochrome c OS=Tetrahymena pyriformis PE=1 SV=1 4 104 6.0E-28
sp|P00084|CYC2_RHOAC Cytochrome c2 OS=Rhodoblastus acidophilus PE=1 SV=1 4 103 1.0E-27
sp|P18822|CYC_TRYBB Cytochrome c (Fragments) OS=Trypanosoma brucei brucei PE=1 SV=1 26 102 2.0E-27
sp|P00080|CYC2_RHOGL Cytochrome c2 OS=Rhodopila globiformis PE=1 SV=1 4 102 4.0E-27
sp|P86323|CYC22_RHOCR Cytochrome c2 OS=Rhodoplanes cryptolactis PE=1 SV=1 9 103 4.0E-27
sp|P00085|CY550_NITWI Cytochrome c-550 OS=Nitrobacter winogradskyi PE=1 SV=1 4 103 1.0E-26
sp|Q45233|CY550_BRADU Cytochrome c-550 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cycA PE=1 SV=1 5 103 1.0E-26
sp|Q8UJ37|CYCM_AGRFC Cytochrome c homolog OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cycM PE=3 SV=1 1 106 5.0E-26
sp|P23021|CY550_STANO Cytochrome c-550 (Fragment) OS=Starkeya novella PE=1 SV=1 8 106 8.0E-26
sp|P00089|CYC22_PHAFV Cytochrome c2 iso-2 OS=Phaeospirillum fulvum PE=1 SV=1 17 103 2.0E-25
sp|P00088|CYC22_PHAMO Cytochrome c2 iso-2 OS=Phaeospirillum molischianum PE=1 SV=1 15 102 3.0E-25
sp|D5QVH0|C554_METTR Cytochrome c-554 OS=Methylosinus trichosporium GN=MettrDRAFT_3796 PE=1 SV=1 1 103 1.0E-24
sp|P86321|CYC2_AFIMA Cytochrome c2 OS=Afifella marina PE=1 SV=1 4 102 2.0E-22
sp|P00081|CYC2_AGRTC Cytochrome c2 OS=Agrobacterium tumefaciens (strain II Chrys) PE=1 SV=1 4 101 5.0E-22
sp|Q05389|CYCY_RHOCB Cytochrome c-type cyt cy OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cycY PE=4 SV=1 4 102 4.0E-21
sp|Q1RHX7|CYCM_RICBR Cytochrome c homolog OS=Rickettsia bellii (strain RML369-C) GN=cycM PE=3 SV=1 1 102 6.0E-21
sp|Q68XB6|CYCM_RICTY Cytochrome c homolog OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=cycM PE=3 SV=1 1 103 6.0E-21
sp|Q92IT3|CYCM_RICCN Cytochrome c homolog OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=cycM PE=3 SV=1 1 102 7.0E-21
sp|P00086|CYC21_PHAFV Cytochrome c2 iso-1 OS=Phaeospirillum fulvum PE=1 SV=1 15 102 9.0E-21
sp|Q4UKP6|CYCM_RICFE Cytochrome c homolog OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=cycM PE=3 SV=1 1 102 1.0E-20
sp|P00087|CYC21_PHAMO Cytochrome c2 iso-1 OS=Phaeospirillum molischianum PE=1 SV=1 15 102 2.0E-20
sp|P54820|CY552_PARDE Cytochrome c-552 OS=Paracoccus denitrificans GN=cycM PE=1 SV=1 1 102 3.0E-20
sp|Q9ZDS2|CYCM_RICPR Cytochrome c homolog OS=Rickettsia prowazekii (strain Madrid E) GN=cycM PE=3 SV=1 1 103 3.0E-20
sp|P00093|CYC2_RHOPH Cytochrome c2 OS=Rhodospirillum photometricum PE=1 SV=1 4 101 2.0E-19
sp|P30323|CYCM_BRADU Cytochrome c homolog OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cycM PE=3 SV=1 21 105 7.0E-18
sp|P86324|CYC23_RHOCR Cytochrome c2 OS=Rhodoplanes cryptolactis PE=1 SV=1 15 102 2.0E-17
sp|P0C189|CYC2_RHORU Cytochrome c2 OS=Rhodospirillum rubrum GN=cycA PE=1 SV=1 4 102 3.0E-16
sp|P81153|CYC21_RHOCE Cytochrome c2 iso-1 OS=Rhodospirillum centenum PE=1 SV=1 4 102 8.0E-15
sp|P81154|CYC22_RHOCE Cytochrome c2 iso-2 OS=Rhodospirillum centenum PE=1 SV=1 4 103 9.0E-15
sp|P00090|CYC21_RHOPL Cytochrome c2 OS=Rhodopseudomonas palustris GN=cycA PE=1 SV=1 5 101 4.0E-14
sp|Q00499|CY550_PARVE Cytochrome c-550 OS=Paracoccus versutus GN=cyc PE=1 SV=1 4 103 9.0E-14
sp|P86318|CYC24_RHOPL Cytochrome c2 OS=Rhodopseudomonas palustris PE=1 SV=1 5 101 9.0E-14
sp|P86317|CYC23_RHOPL Cytochrome c2 OS=Rhodopseudomonas palustris PE=1 SV=1 5 101 1.0E-13
sp|Q2RVM4|CYC2_RHORT Cytochrome c2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=cycA PE=3 SV=1 16 102 1.0E-13
sp|P00091|CYC22_RHOPA Cytochrome c2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cycA PE=1 SV=2 5 101 3.0E-13
sp|P00096|CY550_PARDE Cytochrome c-550 OS=Paracoccus denitrificans GN=cycA PE=1 SV=2 4 103 9.0E-13
sp|P12832|CY550_NOVIT Cytochrome c-550 OS=Novispirillum itersonii PE=1 SV=1 4 101 1.0E-12
sp|P80288|CY550_PARPN Cytochrome c-550 OS=Paracoccus pantotrophus PE=1 SV=1 4 103 1.0E-12
sp|P86320|CYC2_RHOAD Cytochrome c2 OS=Rhodovulum adriaticum PE=1 SV=1 4 101 4.0E-11
sp|P0C0X8|CYC2_RHOSH Cytochrome c2 OS=Rhodobacter sphaeroides GN=cycA PE=1 SV=1 4 104 1.0E-10
sp|Q3J164|CYC2_RHOS4 Cytochrome c2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=cycA PE=1 SV=1 4 104 1.0E-10
sp|P86319|CYC2_RHOBL Cytochrome c2 OS=Rhodobacter blasticus PE=1 SV=1 4 103 1.0E-09
sp|P07625|CY551_ROSDO Cytochrome c-551 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=RD1_0126 PE=1 SV=2 1 105 1.0E-08
sp|P00094|CYC2_RHOCB Cytochrome c2 OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cycA PE=1 SV=1 8 101 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009055 electron transfer activity Yes
GO:0020037 heme binding Yes
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup919
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1621
Ophiocordyceps australis map64 (Brazil) OphauB2|6750 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06723
Ophiocordyceps camponoti-rufipedis Ophun1|464
Ophiocordyceps kimflemingae Ophio5|130
Ophiocordyceps subramaniannii Hirsu2|6238

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6750
MAGGDAKKGAKLFKTRCEQCHTVEAGAGNKIGPALHGLFGRKTGSVEGYSYTDANKQKGITWEEDTLFAYLENPK
KYIPGTKMAFGGLKKDKDRHDLIAYLKEATA*
Coding >OphauB2|6750
ATGGCTGGTGGTGACGCCAAGAAGGGCGCCAAGCTCTTCAAGACTCGCTGCGAACAATGCCACACTGTTGAAGCT
GGCGCCGGCAACAAGATTGGCCCGGCTCTGCACGGCCTCTTTGGCCGCAAGACGGGCTCCGTCGAGGGTTACTCA
TACACGGACGCAAACAAGCAAAAGGGCATCACATGGGAGGAAGACACCCTCTTTGCATACCTCGAGAACCCCAAA
AAGTACATTCCCGGCACCAAAATGGCCTTTGGCGGTCTCAAGAAGGACAAGGACAGACATGACCTCATTGCATAC
CTCAAGGAGGCAACGGCCTAA
Transcript >OphauB2|6750
ATGGCTGGTGGTGACGCCAAGAAGGGCGCCAAGCTCTTCAAGACTCGCTGCGAACAATGCCACACTGTTGAAGCT
GGCGCCGGCAACAAGATTGGCCCGGCTCTGCACGGCCTCTTTGGCCGCAAGACGGGCTCCGTCGAGGGTTACTCA
TACACGGACGCAAACAAGCAAAAGGGCATCACATGGGAGGAAGACACCCTCTTTGCATACCTCGAGAACCCCAAA
AAGTACATTCCCGGCACCAAAATGGCCTTTGGCGGTCTCAAGAAGGACAAGGACAGACATGACCTCATTGCATAC
CTCAAGGAGGCAACGGCCTAA
Gene >OphauB2|6750
ATGGCTGGTGGTAAGTCCTAGTCTTGTCTCCGGGAGAGCCGAAGAGCACCATCTGCAACCGAGGCCATTGGGCGT
GCACGGTATTCGCAACAGCAAGGGCCAAGCAAGAGACGCGTCTCGAGGCACTTGTCCAAGCTGCTGCTCGCCGGC
AAAAGGGCGTTTGCAGGCGCTCGATTTGCTGCAACTCTTGTCTGGCCCATTCTTGTGCTCGCCCAATACTCGTGC
CCAATCGCAGACTGGGCCTGACGCTCTTGCCATTTACGGCCGACGCTTGGCTTGCTGACATGGCATAGGTGACGC
CAAGAAGGGCGCCAAGCTCTTCAAGACTCGCTGCGAACAATGCCACACTGTTGAAGCTGGCGCCGGCAACAAGAT
TGGCCCGGCTCTGCACGGCCTCTTTGGCCGCAAGACGGGCTCCGTCGAGGGTTACTCATACACGGACGCAAACAA
GCAAAAGGGCATCACATGGGAGGAAGACACCCTCTTTGCATACCTCGAGAACCCCAAAAAGTACATTCCCGGCAC
CAAAATGGCCTTTGGCGGTCTCAAGAAGGACAAGGACAGACATGACCTCATTGCGTAAGTTGAAGGTGGTGCGTC
TTGACAAAGAACCGTTGGCTGACGTTGCCCCCGTGGCGCAGATACCTCAAGGAGGCAACGGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail