Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6750
Gene name
LocationContig_64:91396..92062
Strand+
Gene length (bp)666
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00034 Cytochrom_C Cytochrome c 1.8E-11 6 103
PF13442 Cytochrome_CBB3 Cytochrome C oxidase, cbb3-type, subunit III 4.0E-08 5 101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00048|CYC_NEUCR Cytochrome c OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyc-1 PE=1 SV=2 1 106 2.0E-61
sp|Q4HVX7|CYC_GIBZE Cytochrome c OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYC1 PE=3 SV=2 1 105 1.0E-60
sp|P00047|CYC_THELA Cytochrome c OS=Thermomyces lanuginosus PE=1 SV=1 4 105 1.0E-59
sp|P59218|CYC_ROSNE Cytochrome c OS=Rosellinia necatrix GN=CYTC PE=3 SV=1 1 106 5.0E-59
sp|P29380|CYC_ARATH Cytochrome c OS=Arabidopsis thaliana GN=CC-1 PE=3 SV=1 4 105 1.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00048|CYC_NEUCR Cytochrome c OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyc-1 PE=1 SV=2 1 106 2.0E-61
sp|Q4HVX7|CYC_GIBZE Cytochrome c OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYC1 PE=3 SV=2 1 105 1.0E-60
sp|P00047|CYC_THELA Cytochrome c OS=Thermomyces lanuginosus PE=1 SV=1 4 105 1.0E-59
sp|P59218|CYC_ROSNE Cytochrome c OS=Rosellinia necatrix GN=CYTC PE=3 SV=1 1 106 5.0E-59
sp|P29380|CYC_ARATH Cytochrome c OS=Arabidopsis thaliana GN=CC-1 PE=3 SV=1 4 105 1.0E-57
sp|Q96VP3|CYC_COCLU Cytochrome c OS=Cochliobolus lunatus PE=3 SV=1 4 105 1.0E-56
sp|P56205|CYC_ASPNG Cytochrome c OS=Aspergillus niger GN=cycA PE=1 SV=1 1 106 5.0E-56
sp|Q41346|CYC_STELP Cytochrome c OS=Stellaria longipes PE=3 SV=1 4 105 1.0E-55
sp|P38091|CYC_EMENI Cytochrome c OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cycA PE=2 SV=3 4 106 2.0E-54
sp|P00046|CYC_SCHPO Cytochrome c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyc1 PE=1 SV=3 2 106 3.0E-53
sp|P00049|CYC_USTSP Cytochrome c OS=Ustilago sphaerogena PE=1 SV=1 4 105 8.0E-53
sp|P00039|CYC_MANSE Cytochrome c OS=Manduca sexta PE=1 SV=2 1 105 2.0E-50
sp|P53698|CYC_CANAL Cytochrome c OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYC1 PE=3 SV=3 4 106 3.0E-50
sp|Q6Q4H8|CYC_PICPA Cytochrome c OS=Komagataella pastoris GN=CYC1 PE=3 SV=3 4 105 4.0E-50
sp|P00040|CYC_SCHGR Cytochrome c OS=Schistocerca gregaria PE=1 SV=2 4 105 4.0E-50
sp|P25400|CYC_CANGA Cytochrome c OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CYC1 PE=3 SV=1 7 106 7.0E-50
sp|P12831|CYC_SARPE Cytochrome c OS=Sarcophaga peregrina PE=1 SV=2 1 105 7.0E-50
sp|P84029|CYC2_DROME Cytochrome c-2 OS=Drosophila melanogaster GN=Cyt-c-p PE=1 SV=2 1 105 3.0E-49
sp|P84030|CYC2_CERCA Cytochrome c-2 OS=Ceratitis capitata PE=1 SV=2 1 105 3.0E-49
sp|P00036|CYC_LUCCU Cytochrome c OS=Lucilia cuprina PE=1 SV=2 1 105 5.0E-49
sp|P00035|CYC_HAEIR Cytochrome c OS=Haematobia irritans PE=1 SV=2 1 105 6.0E-49
sp|P00020|CYC_ANAPL Cytochrome c OS=Anas platyrhynchos GN=CYC PE=1 SV=2 4 106 8.0E-49
sp|Q6DKE1|CYC2_XENLA Cytochrome c, testis-specific OS=Xenopus laevis GN=cyct PE=3 SV=3 4 106 1.0E-48
sp|O93863|CYC_PACTA Cytochrome c OS=Pachysolen tannophilus GN=CYC1 PE=3 SV=3 4 105 1.0E-48
sp|P00021|CYC_COLLI Cytochrome c OS=Columba livia GN=CYC PE=1 SV=2 4 106 1.0E-48
sp|P00041|CYC_PICKU Cytochrome c OS=Pichia kudriavzevii GN=CYC1 PE=1 SV=1 4 105 1.0E-48
sp|P00045|CYC7_YEAST Cytochrome c iso-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC7 PE=1 SV=1 4 104 2.0E-48
sp|P67882|CYC_MELGA Cytochrome c OS=Meleagris gallopavo GN=CYC PE=1 SV=2 4 106 3.0E-48
sp|P67881|CYC_CHICK Cytochrome c OS=Gallus gallus GN=CYC PE=1 SV=2 4 106 3.0E-48
sp|P21665|CYC_VARVA Cytochrome c OS=Varanus varius PE=1 SV=2 4 106 6.0E-48
sp|O13393|CYC_PICST Cytochrome c OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CYC1 PE=3 SV=3 4 105 6.0E-48
sp|P19681|CYC_SCHOC Cytochrome c OS=Schwanniomyces occidentalis GN=CYC1 PE=3 SV=2 4 105 6.0E-48
sp|P00017|CYC_APTPA Cytochrome c OS=Aptenodytes patagonicus GN=CYC PE=1 SV=2 4 106 6.0E-48
sp|P00042|CYC_WICAO Cytochrome c OS=Wickerhamomyces anomalus PE=1 SV=1 4 105 8.0E-48
sp|Q6PBF4|CYC2_XENTR Cytochrome c, testis-specific OS=Xenopus tropicalis GN=cyct PE=3 SV=3 4 106 1.0E-47
sp|P00044|CYC1_YEAST Cytochrome c iso-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC1 PE=1 SV=2 4 104 1.0E-47
sp|P00018|CYC_DRONO Cytochrome c OS=Dromaius novaehollandiae GN=CYC PE=1 SV=2 4 106 3.0E-47
sp|Q6QLW4|CYC_PECGU Cytochrome c OS=Pectinaria gouldii PE=3 SV=1 1 105 3.0E-47
sp|P00068|CYC_WHEAT Cytochrome c OS=Triticum aestivum PE=1 SV=1 4 106 4.0E-47
sp|P00037|CYC_SAMCY Cytochrome c OS=Samia cynthia PE=1 SV=2 1 105 5.0E-47
sp|P68096|CYC_EQUBU Cytochrome c OS=Equus burchelli GN=CYCS PE=1 SV=2 4 105 5.0E-47
sp|P68097|CYC_EQUAS Cytochrome c OS=Equus asinus GN=CYCS PE=1 SV=2 4 105 5.0E-47
sp|P00043|CYC_DEBHA Cytochrome c OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CYC1 PE=1 SV=3 4 105 6.0E-47
sp|P00019|CYC_STRCA Cytochrome c OS=Struthio camelus GN=CYC PE=1 SV=2 4 106 6.0E-47
sp|P00008|CYC_RABIT Cytochrome c OS=Oryctolagus cuniculus GN=CYCS PE=1 SV=2 4 105 1.0E-46
sp|P00004|CYC_HORSE Cytochrome c OS=Equus caballus GN=CYCS PE=1 SV=2 4 105 2.0E-46
sp|P62898|CYC_RAT Cytochrome c, somatic OS=Rattus norvegicus GN=Cycs PE=1 SV=2 4 105 2.0E-46
sp|P62897|CYC_MOUSE Cytochrome c, somatic OS=Mus musculus GN=Cycs PE=1 SV=2 4 105 2.0E-46
sp|O23138|CYC1_ARATH Cytochrome c-1 OS=Arabidopsis thaliana GN=CYTC-1 PE=1 SV=1 4 106 2.0E-46
sp|Q6C9Q0|CYC_YARLI Cytochrome c OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CYC1 PE=3 SV=1 4 103 2.0E-46
sp|P62896|CYC_SHEEP Cytochrome c OS=Ovis aries GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|P62895|CYC_PIG Cytochrome c OS=Sus scrofa GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|Q52V08|CYC_MACSY Cytochrome c OS=Macaca sylvanus GN=CYCS PE=3 SV=3 4 105 4.0E-46
sp|P00002|CYC_MACMU Cytochrome c OS=Macaca mulatta GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|P62894|CYC_BOVIN Cytochrome c OS=Bos taurus GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|Q6IQM2|CYC_DANRE Cytochrome c OS=Danio rerio GN=cyc PE=3 SV=3 4 106 4.0E-46
sp|P00025|CYC_KATPE Cytochrome c OS=Katsuwonus pelamis GN=cyc PE=1 SV=2 4 106 4.0E-46
sp|O22642|CYC_FRIAG Cytochrome c OS=Fritillaria agrestis GN=CYTC PE=3 SV=3 4 106 4.0E-46
sp|P00007|CYC_HIPAM Cytochrome c OS=Hippopotamus amphibius GN=CYCS PE=1 SV=2 4 105 4.0E-46
sp|P00051|CYC_CUCMA Cytochrome c OS=Cucurbita maxima PE=1 SV=1 4 106 6.0E-46
sp|P81459|CYC_THUAA Cytochrome c OS=Thunnus alalunga GN=cyc PE=1 SV=1 4 106 6.0E-46
sp|P62773|CYC_BRAOL Cytochrome c OS=Brassica oleracea PE=1 SV=1 4 106 6.0E-46
sp|P62772|CYC_BRANA Cytochrome c OS=Brassica napus PE=1 SV=1 4 106 6.0E-46
sp|P32556|CYC_KLULA Cytochrome c OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CYCK PE=3 SV=1 4 104 6.0E-46
sp|P00011|CYC_CANLF Cytochrome c OS=Canis lupus familiaris GN=CYCS PE=1 SV=2 4 105 7.0E-46
sp|P00013|CYC_MINSC Cytochrome c OS=Miniopterus schreibersii GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P00038|CYC_APIME Cytochrome c OS=Apis mellifera GN=cytC PE=1 SV=2 1 105 8.0E-46
sp|P68098|CYC_LAMGU Cytochrome c OS=Lama guanicoe GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P68100|CYC_ESCRO Cytochrome c OS=Eschrichtius robustus GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P68099|CYC_CAMDR Cytochrome c OS=Camelus dromedarius GN=CYCS PE=1 SV=2 4 105 8.0E-46
sp|P00027|CYC_SQUSU Cytochrome c OS=Squalus suckleyi GN=cyc PE=1 SV=2 4 106 1.0E-45
sp|P81280|CYC_ALLMI Cytochrome c OS=Alligator mississippiensis PE=1 SV=2 4 106 1.0E-45
sp|P00059|CYC_ABUTH Cytochrome c OS=Abutilon theophrasti PE=1 SV=1 4 106 1.0E-45
sp|P68519|CYC_CROVV Cytochrome c OS=Crotalus viridis viridis PE=1 SV=2 4 106 1.0E-45
sp|P68518|CYC_CROAT Cytochrome c OS=Crotalus atrox PE=1 SV=2 4 106 1.0E-45
sp|P68517|CYC_CROAD Cytochrome c OS=Crotalus adamanteus PE=1 SV=2 4 106 1.0E-45
sp|P00069|CYC_GUIAB Cytochrome c OS=Guizotia abyssinica PE=1 SV=1 4 106 1.0E-45
sp|P00012|CYC_MIRLE Cytochrome c OS=Mirounga leonina GN=CYCS PE=1 SV=2 4 105 2.0E-45
sp|Q5RFH4|CYC_PONAB Cytochrome c OS=Pongo abelii GN=CYCS PE=3 SV=3 4 105 2.0E-45
sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN=CYCS PE=1 SV=2 4 105 2.0E-45
sp|P99999|CYC_HUMAN Cytochrome c OS=Homo sapiens GN=CYCS PE=1 SV=2 4 105 2.0E-45
sp|Q6WUX8|CYC_GORGO Cytochrome c OS=Gorilla gorilla gorilla GN=CYCS PE=3 SV=3 4 105 2.0E-45
sp|P00064|CYC_ALLPO Cytochrome c OS=Allium porrum PE=1 SV=1 4 106 2.0E-45
sp|Q4SG99|CYC_TETNG Cytochrome c OS=Tetraodon nigroviridis GN=cyc PE=3 SV=1 4 106 2.0E-45
sp|P00052|CYC_VIGRR Cytochrome c OS=Vigna radiata var. radiata PE=1 SV=1 4 106 2.0E-45
sp|P00066|CYC_NIGDA Cytochrome c OS=Nigella damascena PE=1 SV=1 4 106 3.0E-45
sp|P00057|CYC_RICCO Cytochrome c OS=Ricinus communis PE=1 SV=1 4 106 3.0E-45
sp|P00056|CYC_MAIZE Cytochrome c OS=Zea mays PE=1 SV=1 4 106 3.0E-45
sp|Q52V09|CYC_TARBA Cytochrome c OS=Tarsius bancanus GN=CYCS PE=3 SV=3 4 105 3.0E-45
sp|P00028|CYC_LAMTR Cytochrome c OS=Lampetra tridentata GN=cyc PE=1 SV=2 4 106 4.0E-45
sp|P00026|CYC_CYPCA Cytochrome c iso-1/iso-2 OS=Cyprinus carpio GN=cyc PE=1 SV=3 4 106 4.0E-45
sp|P00072|CYC_FAGES Cytochrome c OS=Fagopyrum esculentum PE=1 SV=1 4 105 4.0E-45
sp|P00022|CYC_CHESE Cytochrome c OS=Chelydra serpentina PE=1 SV=2 4 106 5.0E-45
sp|P00003|CYC_ATESP Cytochrome c OS=Ateles sp. GN=CYCS PE=1 SV=3 4 105 6.0E-45
sp|Q6GQE4|CYC1A_XENLA Cytochrome c, somatic A OS=Xenopus laevis GN=cycs-a PE=3 SV=3 4 106 6.0E-45
sp|P00058|CYC_GOSBA Cytochrome c OS=Gossypium barbadense PE=1 SV=1 4 106 7.0E-45
sp|P00061|CYC_SOLTU Cytochrome c OS=Solanum tuberosum PE=1 SV=1 4 106 7.0E-45
sp|Q9T0G2|CYC2_ARATH Cytochrome c-2 OS=Arabidopsis thaliana GN=CYTC-2 PE=1 SV=1 4 106 7.0E-45
sp|P00029|CYC_ASTRU Cytochrome c OS=Asterias rubens PE=1 SV=2 4 105 9.0E-45
sp|Q1KKS2|CYCB_TAKRU Cytochrome c-b OS=Takifugu rubripes GN=cyc-B PE=3 SV=1 4 106 9.0E-45
sp|P00062|CYC_SAMNI Cytochrome c OS=Sambucus nigra PE=1 SV=1 4 106 1.0E-44
sp|Q0DI31|CYC_ORYSJ Cytochrome c OS=Oryza sativa subsp. japonica GN=CC-1 PE=1 SV=1 4 106 1.0E-44
sp|A2Y4S9|CYC_ORYSI Cytochrome c OS=Oryza sativa subsp. indica GN=CC-1 PE=3 SV=1 4 106 1.0E-44
sp|P00031|CYC_MACMA Cytochrome c OS=Macrobrachium malcolmsonii PE=1 SV=2 4 105 1.0E-44
sp|Q640U4|CYC1_XENTR Cytochrome c, somatic OS=Xenopus tropicalis GN=cycs PE=3 SV=3 4 106 1.0E-44
sp|P00067|CYC_TROMA Cytochrome c OS=Tropaeolum majus PE=1 SV=1 4 106 1.0E-44
sp|P00030|CYC_EISFE Cytochrome c OS=Eisenia fetida PE=1 SV=1 1 105 1.0E-44
sp|P10715|CYC2_RAT Cytochrome c, testis-specific OS=Rattus norvegicus GN=Cyct PE=2 SV=2 4 106 2.0E-44
sp|P00054|CYC_SESIN Cytochrome c OS=Sesamum indicum PE=1 SV=1 4 106 2.0E-44
sp|Q52V10|CYC_SAISC Cytochrome c OS=Saimiri sciureus GN=CYCS PE=3 SV=3 4 105 2.0E-44
sp|P00024|CYC_LITCT Cytochrome c OS=Lithobates catesbeiana PE=1 SV=2 4 106 2.0E-44
sp|P00060|CYC_SOLLC Cytochrome c OS=Solanum lycopersicum PE=1 SV=2 4 106 2.0E-44
sp|P00074|CYC_GINBI Cytochrome c OS=Ginkgo biloba PE=1 SV=1 4 106 2.0E-44
sp|Q7YR71|CYC_TRACR Cytochrome c OS=Trachypithecus cristatus GN=CYCS PE=3 SV=3 4 105 3.0E-44
sp|P00053|CYC_CANSA Cytochrome c OS=Cannabis sativa PE=1 SV=1 4 106 3.0E-44
sp|P00071|CYC_PASSA Cytochrome c OS=Pastinaca sativa PE=1 SV=1 4 106 4.0E-44
sp|P00015|CYC2_MOUSE Cytochrome c, testis-specific OS=Mus musculus GN=Cyct PE=1 SV=3 4 106 4.0E-44
sp|P00073|CYC_SPIOL Cytochrome c OS=Spinacia oleracea PE=1 SV=1 4 105 4.0E-44
sp|Q1KL06|CYCA_TAKRU Cytochrome c-a OS=Takifugu rubripes GN=cyc-a PE=3 SV=1 4 106 4.0E-44
sp|B4USV4|CYC_OTOGA Cytochrome c OS=Otolemur garnettii GN=CYCS PE=3 SV=1 5 105 5.0E-44
sp|P00014|CYC_MACGI Cytochrome c OS=Macropus giganteus GN=CYCS PE=1 SV=2 4 105 5.0E-44
sp|P00070|CYC_HELAN Cytochrome c OS=Helianthus annuus GN=CYTC1 PE=1 SV=3 4 106 8.0E-44
sp|P00065|CYC_ARUMA Cytochrome c OS=Arum maculatum PE=1 SV=1 4 106 9.0E-44
sp|Q753F4|CYC_ASHGO Cytochrome c OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CYC1 PE=3 SV=2 4 104 1.0E-43
sp|P00032|CYC_HELAS Cytochrome c OS=Helix aspersa PE=1 SV=1 4 105 3.0E-43
sp|Q6NTN0|CYC1B_XENLA Cytochrome c, somatic B OS=Xenopus laevis GN=cycs-b PE=3 SV=3 4 106 5.0E-43
sp|P00075|CYC_ULVIN Cytochrome c OS=Ulva intestinalis PE=1 SV=1 4 106 5.0E-43
sp|Q3SZT9|CYC2_BOVIN Cytochrome c 2 OS=Bos taurus GN=CYCT PE=3 SV=3 5 106 1.0E-42
sp|P00063|CYC_ACENE Cytochrome c OS=Acer negundo PE=1 SV=1 4 106 5.0E-42
sp|Q4N594|CYC_THEPA Cytochrome c OS=Theileria parva GN=TP02_0396 PE=3 SV=1 4 106 9.0E-42
sp|Q4UEA0|CYC_THEAN Cytochrome c OS=Theileria annulata GN=TA12950 PE=3 SV=1 4 106 1.0E-41
sp|P15451|CYC_CHLRE Cytochrome c OS=Chlamydomonas reinhardtii GN=CYC1 PE=3 SV=2 4 106 5.0E-40
sp|P00076|CYC_EUGGR Cytochrome c OS=Euglena gracilis PE=1 SV=1 4 102 3.0E-39
sp|Q869N1|CYC_DICDI Cytochrome c OS=Dictyostelium discoideum GN=cytC PE=3 SV=1 1 105 7.0E-38
sp|P00078|CYC_CRIFA Cytochrome c OS=Crithidia fasciculata PE=1 SV=2 1 102 9.0E-38
sp|P22342|CYC_EUGVI Cytochrome c OS=Euglena viridis PE=1 SV=1 4 102 1.0E-37
sp|P04657|CYC1_DROME Cytochrome c-1 OS=Drosophila melanogaster GN=Cyt-c-d PE=2 SV=2 1 102 2.0E-37
sp|P92504|CYC1_ASCSU Cytochrome c type-1 OS=Ascaris suum PE=1 SV=3 1 103 2.0E-37
sp|P19974|CYC21_CAEEL Cytochrome c 2.1 OS=Caenorhabditis elegans GN=cyc-2.1 PE=1 SV=2 1 106 4.0E-37
sp|A8WQY3|CYC21_CAEBR Cytochrome c 2.1 OS=Caenorhabditis briggsae GN=cyc-2.1 PE=3 SV=1 1 102 1.0E-35
sp|Q23240|CYC22_CAEEL Probable cytochrome c 2.2 OS=Caenorhabditis elegans GN=cyc-2.2 PE=3 SV=1 4 106 3.0E-35
sp|P00077|CYC_STROO Cytochrome c OS=Strigomonas oncopelti PE=1 SV=2 1 102 2.0E-34
sp|P92505|CYC2_ASCSU Cytochrome c type-2 OS=Ascaris suum PE=2 SV=3 4 102 3.0E-34
sp|A8X769|CYC22_CAEBR Probable cytochrome c 2.2 OS=Caenorhabditis briggsae GN=cyc-2.2 PE=3 SV=2 4 102 3.0E-32
sp|P00083|CYC2_BLAVI Cytochrome c2 OS=Blastochloris viridis GN=cycA PE=1 SV=2 9 106 8.0E-32
sp|P86322|CYC21_RHOCR Cytochrome c2 OS=Rhodoplanes cryptolactis PE=1 SV=1 5 103 4.0E-31
sp|P00082|CYC2_RHOVT Cytochrome c2 OS=Rhodomicrobium vannielii (strain ATCC 17100 / ATH 3.1.1 / DSM 162 / LMG 4299) GN=Rvan_1007 PE=1 SV=2 2 101 4.0E-28
sp|P00079|CYC_TETPY Cytochrome c OS=Tetrahymena pyriformis PE=1 SV=1 4 104 6.0E-28
sp|P00084|CYC2_RHOAC Cytochrome c2 OS=Rhodoblastus acidophilus PE=1 SV=1 4 103 1.0E-27
sp|P18822|CYC_TRYBB Cytochrome c (Fragments) OS=Trypanosoma brucei brucei PE=1 SV=1 26 102 2.0E-27
sp|P00080|CYC2_RHOGL Cytochrome c2 OS=Rhodopila globiformis PE=1 SV=1 4 102 4.0E-27
sp|P86323|CYC22_RHOCR Cytochrome c2 OS=Rhodoplanes cryptolactis PE=1 SV=1 9 103 4.0E-27
sp|P00085|CY550_NITWI Cytochrome c-550 OS=Nitrobacter winogradskyi PE=1 SV=1 4 103 1.0E-26
sp|Q45233|CY550_BRADU Cytochrome c-550 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cycA PE=1 SV=1 5 103 1.0E-26
sp|Q8UJ37|CYCM_AGRFC Cytochrome c homolog OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cycM PE=3 SV=1 1 106 5.0E-26
sp|P23021|CY550_STANO Cytochrome c-550 (Fragment) OS=Starkeya novella PE=1 SV=1 8 106 8.0E-26
sp|P00089|CYC22_PHAFV Cytochrome c2 iso-2 OS=Phaeospirillum fulvum PE=1 SV=1 17 103 2.0E-25
sp|P00088|CYC22_PHAMO Cytochrome c2 iso-2 OS=Phaeospirillum molischianum PE=1 SV=1 15 102 3.0E-25
sp|D5QVH0|C554_METTR Cytochrome c-554 OS=Methylosinus trichosporium GN=MettrDRAFT_3796 PE=1 SV=1 1 103 1.0E-24
sp|P86321|CYC2_AFIMA Cytochrome c2 OS=Afifella marina PE=1 SV=1 4 102 2.0E-22
sp|P00081|CYC2_AGRTC Cytochrome c2 OS=Agrobacterium tumefaciens (strain II Chrys) PE=1 SV=1 4 101 5.0E-22
sp|Q05389|CYCY_RHOCB Cytochrome c-type cyt cy OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cycY PE=4 SV=1 4 102 4.0E-21
sp|Q1RHX7|CYCM_RICBR Cytochrome c homolog OS=Rickettsia bellii (strain RML369-C) GN=cycM PE=3 SV=1 1 102 6.0E-21
sp|Q68XB6|CYCM_RICTY Cytochrome c homolog OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=cycM PE=3 SV=1 1 103 6.0E-21
sp|Q92IT3|CYCM_RICCN Cytochrome c homolog OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=cycM PE=3 SV=1 1 102 7.0E-21
sp|P00086|CYC21_PHAFV Cytochrome c2 iso-1 OS=Phaeospirillum fulvum PE=1 SV=1 15 102 9.0E-21
sp|Q4UKP6|CYCM_RICFE Cytochrome c homolog OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=cycM PE=3 SV=1 1 102 1.0E-20
sp|P00087|CYC21_PHAMO Cytochrome c2 iso-1 OS=Phaeospirillum molischianum PE=1 SV=1 15 102 2.0E-20
sp|P54820|CY552_PARDE Cytochrome c-552 OS=Paracoccus denitrificans GN=cycM PE=1 SV=1 1 102 3.0E-20
sp|Q9ZDS2|CYCM_RICPR Cytochrome c homolog OS=Rickettsia prowazekii (strain Madrid E) GN=cycM PE=3 SV=1 1 103 3.0E-20
sp|P00093|CYC2_RHOPH Cytochrome c2 OS=Rhodospirillum photometricum PE=1 SV=1 4 101 2.0E-19
sp|P30323|CYCM_BRADU Cytochrome c homolog OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cycM PE=3 SV=1 21 105 7.0E-18
sp|P86324|CYC23_RHOCR Cytochrome c2 OS=Rhodoplanes cryptolactis PE=1 SV=1 15 102 2.0E-17
sp|P0C189|CYC2_RHORU Cytochrome c2 OS=Rhodospirillum rubrum GN=cycA PE=1 SV=1 4 102 3.0E-16
sp|P81153|CYC21_RHOCE Cytochrome c2 iso-1 OS=Rhodospirillum centenum PE=1 SV=1 4 102 8.0E-15
sp|P81154|CYC22_RHOCE Cytochrome c2 iso-2 OS=Rhodospirillum centenum PE=1 SV=1 4 103 9.0E-15
sp|P00090|CYC21_RHOPL Cytochrome c2 OS=Rhodopseudomonas palustris GN=cycA PE=1 SV=1 5 101 4.0E-14
sp|Q00499|CY550_PARVE Cytochrome c-550 OS=Paracoccus versutus GN=cyc PE=1 SV=1 4 103 9.0E-14
sp|P86318|CYC24_RHOPL Cytochrome c2 OS=Rhodopseudomonas palustris PE=1 SV=1 5 101 9.0E-14
sp|P86317|CYC23_RHOPL Cytochrome c2 OS=Rhodopseudomonas palustris PE=1 SV=1 5 101 1.0E-13
sp|Q2RVM4|CYC2_RHORT Cytochrome c2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=cycA PE=3 SV=1 16 102 1.0E-13
sp|P00091|CYC22_RHOPA Cytochrome c2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cycA PE=1 SV=2 5 101 3.0E-13
sp|P00096|CY550_PARDE Cytochrome c-550 OS=Paracoccus denitrificans GN=cycA PE=1 SV=2 4 103 9.0E-13
sp|P12832|CY550_NOVIT Cytochrome c-550 OS=Novispirillum itersonii PE=1 SV=1 4 101 1.0E-12
sp|P80288|CY550_PARPN Cytochrome c-550 OS=Paracoccus pantotrophus PE=1 SV=1 4 103 1.0E-12
sp|P86320|CYC2_RHOAD Cytochrome c2 OS=Rhodovulum adriaticum PE=1 SV=1 4 101 4.0E-11
sp|P0C0X8|CYC2_RHOSH Cytochrome c2 OS=Rhodobacter sphaeroides GN=cycA PE=1 SV=1 4 104 1.0E-10
sp|Q3J164|CYC2_RHOS4 Cytochrome c2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=cycA PE=1 SV=1 4 104 1.0E-10
sp|P86319|CYC2_RHOBL Cytochrome c2 OS=Rhodobacter blasticus PE=1 SV=1 4 103 1.0E-09
sp|P07625|CY551_ROSDO Cytochrome c-551 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=RD1_0126 PE=1 SV=2 1 105 1.0E-08
sp|P00094|CYC2_RHOCB Cytochrome c2 OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cycA PE=1 SV=1 8 101 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009055 electron transfer activity Yes
GO:0020037 heme binding Yes
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6750
MAGGDAKKGAKLFKTRCEQCHTVEAGAGNKIGPALHGLFGRKTGSVEGYSYTDANKQKGITWEEDTLFAYLENPK
KYIPGTKMAFGGLKKDKDRHDLIAYLKEATA*
Coding >OphauB2|6750
ATGGCTGGTGGTGACGCCAAGAAGGGCGCCAAGCTCTTCAAGACTCGCTGCGAACAATGCCACACTGTTGAAGCT
GGCGCCGGCAACAAGATTGGCCCGGCTCTGCACGGCCTCTTTGGCCGCAAGACGGGCTCCGTCGAGGGTTACTCA
TACACGGACGCAAACAAGCAAAAGGGCATCACATGGGAGGAAGACACCCTCTTTGCATACCTCGAGAACCCCAAA
AAGTACATTCCCGGCACCAAAATGGCCTTTGGCGGTCTCAAGAAGGACAAGGACAGACATGACCTCATTGCATAC
CTCAAGGAGGCAACGGCCTAA
Transcript >OphauB2|6750
ATGGCTGGTGGTGACGCCAAGAAGGGCGCCAAGCTCTTCAAGACTCGCTGCGAACAATGCCACACTGTTGAAGCT
GGCGCCGGCAACAAGATTGGCCCGGCTCTGCACGGCCTCTTTGGCCGCAAGACGGGCTCCGTCGAGGGTTACTCA
TACACGGACGCAAACAAGCAAAAGGGCATCACATGGGAGGAAGACACCCTCTTTGCATACCTCGAGAACCCCAAA
AAGTACATTCCCGGCACCAAAATGGCCTTTGGCGGTCTCAAGAAGGACAAGGACAGACATGACCTCATTGCATAC
CTCAAGGAGGCAACGGCCTAA
Gene >OphauB2|6750
ATGGCTGGTGGTAAGTCCTAGTCTTGTCTCCGGGAGAGCCGAAGAGCACCATCTGCAACCGAGGCCATTGGGCGT
GCACGGTATTCGCAACAGCAAGGGCCAAGCAAGAGACGCGTCTCGAGGCACTTGTCCAAGCTGCTGCTCGCCGGC
AAAAGGGCGTTTGCAGGCGCTCGATTTGCTGCAACTCTTGTCTGGCCCATTCTTGTGCTCGCCCAATACTCGTGC
CCAATCGCAGACTGGGCCTGACGCTCTTGCCATTTACGGCCGACGCTTGGCTTGCTGACATGGCATAGGTGACGC
CAAGAAGGGCGCCAAGCTCTTCAAGACTCGCTGCGAACAATGCCACACTGTTGAAGCTGGCGCCGGCAACAAGAT
TGGCCCGGCTCTGCACGGCCTCTTTGGCCGCAAGACGGGCTCCGTCGAGGGTTACTCATACACGGACGCAAACAA
GCAAAAGGGCATCACATGGGAGGAAGACACCCTCTTTGCATACCTCGAGAACCCCAAAAAGTACATTCCCGGCAC
CAAAATGGCCTTTGGCGGTCTCAAGAAGGACAAGGACAGACATGACCTCATTGCGTAAGTTGAAGGTGGTGCGTC
TTGACAAAGAACCGTTGGCTGACGTTGCCCCCGTGGCGCAGATACCTCAAGGAGGCAACGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail