Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6739
Gene name
LocationContig_64:65334..67256
Strand-
Gene length (bp)1922
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00447 HSF_DNA-bind HSF-type DNA-binding 6.6E-31 71 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A287|SFL1_CANAL Transcription factor SFL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFL1 PE=1 SV=1 70 181 5.0E-31
sp|Q5AK51|SFL2_CANAL Transcription factor SFL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFL2 PE=1 SV=2 64 205 6.0E-27
sp|P20134|SFL1_YEAST Flocculation suppression protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFL1 PE=1 SV=3 71 171 1.0E-24
sp|Q02953|HSF_SCHPO Heat shock factor protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsf1 PE=1 SV=2 69 233 5.0E-18
sp|Q9SCW4|HFB2A_ARATH Heat stress transcription factor B-2a OS=Arabidopsis thaliana GN=HSFB2A PE=2 SV=1 53 170 8.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A287|SFL1_CANAL Transcription factor SFL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFL1 PE=1 SV=1 70 181 5.0E-31
sp|Q5AK51|SFL2_CANAL Transcription factor SFL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFL2 PE=1 SV=2 64 205 6.0E-27
sp|P20134|SFL1_YEAST Flocculation suppression protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFL1 PE=1 SV=3 71 171 1.0E-24
sp|Q02953|HSF_SCHPO Heat shock factor protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsf1 PE=1 SV=2 69 233 5.0E-18
sp|Q9SCW4|HFB2A_ARATH Heat stress transcription factor B-2a OS=Arabidopsis thaliana GN=HSFB2A PE=2 SV=1 53 170 8.0E-18
sp|O14283|PRR1_SCHPO Transcription factor prr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prr1 PE=1 SV=2 71 190 9.0E-18
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 71 262 7.0E-17
sp|Q9T0D3|HFB2B_ARATH Heat stress transcription factor B-2b OS=Arabidopsis thaliana GN=HSFB2B PE=2 SV=1 69 170 1.0E-16
sp|Q9ULV5|HSF4_HUMAN Heat shock factor protein 4 OS=Homo sapiens GN=HSF4 PE=1 SV=2 53 171 1.0E-16
sp|Q1HGE8|HSF4_CANLF Heat shock factor protein 4 OS=Canis lupus familiaris GN=HSF4 PE=2 SV=1 53 171 2.0E-16
sp|Q9R0L1|HSF4_MOUSE Heat shock factor protein 4 OS=Mus musculus GN=Hsf4 PE=1 SV=2 53 171 3.0E-16
sp|P22121|HSF_KLULA Heat shock factor protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSF PE=1 SV=1 70 177 3.0E-16
sp|Q08DJ8|HSF1_BOVIN Heat shock factor protein 1 OS=Bos taurus GN=HSF1 PE=2 SV=1 56 254 4.0E-16
sp|Q6Z9C8|HFB2B_ORYSJ Heat stress transcription factor B-2b OS=Oryza sativa subsp. japonica GN=HSFB2B PE=2 SV=1 62 170 6.0E-16
sp|O81821|HFA1B_ARATH Heat stress transcription factor A-1b OS=Arabidopsis thaliana GN=HSFA1B PE=2 SV=2 71 174 1.0E-15
sp|P10961|HSF_YEAST Heat shock factor protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSF1 PE=1 SV=1 70 170 1.0E-15
sp|P38532|HSF1_MOUSE Heat shock factor protein 1 OS=Mus musculus GN=Hsf1 PE=1 SV=2 70 267 2.0E-15
sp|Q00613|HSF1_HUMAN Heat shock factor protein 1 OS=Homo sapiens GN=HSF1 PE=1 SV=1 56 254 2.0E-15
sp|P22335|HSF24_SOLPE Heat shock factor protein HSF24 OS=Solanum peruvianum GN=HSF24 PE=2 SV=1 71 172 3.0E-15
sp|Q1PDN3|HFA6A_ARATH Heat stress transcription factor A-6a OS=Arabidopsis thaliana GN=HSFA6A PE=2 SV=1 69 172 3.0E-15
sp|P41154|HSF_XENLA Heat shock factor protein OS=Xenopus laevis GN=hsf1 PE=2 SV=1 70 254 5.0E-15
sp|P38529|HSF1_CHICK Heat shock factor protein 1 OS=Gallus gallus GN=HSF1 PE=2 SV=1 69 248 7.0E-15
sp|P38531|HSF3_CHICK Heat shock factor protein 3 OS=Gallus gallus GN=HSF3 PE=2 SV=1 54 225 9.0E-15
sp|Q652B0|HFB2C_ORYSJ Heat stress transcription factor B-2c OS=Oryza sativa subsp. japonica GN=HSFB2C PE=2 SV=1 69 170 1.0E-14
sp|Q93VB5|HFA4D_ORYSJ Heat stress transcription factor A-4d OS=Oryza sativa subsp. japonica GN=HSFA4D PE=1 SV=1 71 262 2.0E-14
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 50 264 2.0E-14
sp|P22813|HSF_DROME Heat shock factor protein OS=Drosophila melanogaster GN=Hsf PE=1 SV=1 70 174 2.0E-14
sp|Q96320|HSFB1_ARATH Heat stress transcription factor B-1 OS=Arabidopsis thaliana GN=HSFB1 PE=2 SV=2 71 172 2.0E-14
sp|Q03933|HSF2_HUMAN Heat shock factor protein 2 OS=Homo sapiens GN=HSF2 PE=1 SV=1 70 213 2.0E-14
sp|Q94J16|HFA4B_ORYSJ Heat stress transcription factor A-4b OS=Oryza sativa subsp. japonica GN=HSFA4B PE=2 SV=1 71 262 3.0E-14
sp|P38533|HSF2_MOUSE Heat shock factor protein 2 OS=Mus musculus GN=Hsf2 PE=2 SV=2 70 213 3.0E-14
sp|Q94BZ5|HSFA5_ARATH Heat stress transcription factor A-5 OS=Arabidopsis thaliana GN=HSFA5 PE=2 SV=1 71 178 3.0E-14
sp|Q9S7U5|HSFA8_ARATH Heat stress transcription factor A-8 OS=Arabidopsis thaliana GN=HSFA8 PE=2 SV=1 71 172 3.0E-14
sp|Q6F388|HFA2E_ORYSJ Heat stress transcription factor A-2e OS=Oryza sativa subsp. japonica GN=HSFA2E PE=2 SV=1 71 260 6.0E-14
sp|Q9C635|HSFB4_ARATH Heat stress transcription factor B-4 OS=Arabidopsis thaliana GN=HSFB4 PE=2 SV=1 63 176 6.0E-14
sp|P41151|HFA1A_ARATH Heat stress transcription factor A-1a OS=Arabidopsis thaliana GN=HSFA1A PE=1 SV=2 23 172 6.0E-14
sp|O80982|HSFA2_ARATH Heat stress transcription factor A-2 OS=Arabidopsis thaliana GN=HSFA2 PE=1 SV=1 71 178 7.0E-14
sp|P41152|HSF30_SOLPE Heat shock factor protein HSF30 OS=Solanum peruvianum GN=HSF30 PE=2 SV=1 71 205 8.0E-14
sp|Q40152|HSF8_SOLLC Heat shock factor protein HSF8 OS=Solanum lycopersicum GN=HSF8 PE=3 SV=1 71 263 1.0E-13
sp|Q9LQM7|HFA1D_ARATH Heat stress transcription factor A-1d OS=Arabidopsis thaliana GN=HSFA1D PE=1 SV=2 47 264 1.0E-13
sp|Q10PR4|HSFA9_ORYSJ Heat stress transcription factor A-9 OS=Oryza sativa subsp. japonica GN=HSFA9 PE=2 SV=1 58 273 1.0E-13
sp|Q67TP9|HSFB1_ORYSJ Heat stress transcription factor B-1 OS=Oryza sativa subsp. japonica GN=HSFB1 PE=2 SV=1 71 172 1.0E-13
sp|P38530|HSF2_CHICK Heat shock factor protein 2 OS=Gallus gallus GN=HSF2 PE=2 SV=1 70 172 1.0E-13
sp|Q9LUH8|HFA6B_ARATH Heat stress transcription factor A-6b OS=Arabidopsis thaliana GN=HSFA6b PE=2 SV=1 71 172 2.0E-13
sp|Q6EUG4|HFC2A_ORYSJ Heat stress transcription factor C-2a OS=Oryza sativa subsp. japonica GN=HSFC2A PE=2 SV=1 71 172 2.0E-13
sp|Q6VBB2|HFA2B_ORYSJ Heat stress transcription factor A-2b OS=Oryza sativa subsp. japonica GN=HSFA2B PE=2 SV=1 71 170 3.0E-13
sp|Q657C0|HFA6B_ORYSJ Heat stress transcription factor A-6a OS=Oryza sativa subsp. japonica GN=HSFA6B PE=2 SV=1 32 263 3.0E-13
sp|O22230|HSFB3_ARATH Heat stress transcription factor B-3 OS=Arabidopsis thaliana GN=HSFB3 PE=2 SV=1 71 189 4.0E-13
sp|Q84T61|HSFA1_ORYSJ Heat stress transcription factor A-1 OS=Oryza sativa subsp. japonica GN=HSFA1 PE=2 SV=1 71 175 4.0E-13
sp|Q9SCW5|HFA1E_ARATH Heat stress transcription factor A-1e OS=Arabidopsis thaliana GN=HSFA1E PE=2 SV=2 42 170 4.0E-13
sp|P41153|HSF8_SOLPE Heat shock factor protein HSF8 OS=Solanum peruvianum GN=HSF8 PE=2 SV=1 71 170 5.0E-13
sp|Q9LVW2|HSFA9_ARATH Heat stress transcription factor A-9 OS=Arabidopsis thaliana GN=HSFA9 PE=2 SV=1 61 181 6.0E-13
sp|Q7XRX3|HFB2A_ORYSJ Heat stress transcription factor B-2a OS=Oryza sativa subsp. japonica GN=HSFB2A PE=2 SV=2 71 170 9.0E-13
sp|Q0DBL6|HFC2B_ORYSJ Heat stress transcription factor C-2b OS=Oryza sativa subsp. japonica GN=HSFC2B PE=3 SV=1 71 170 1.0E-12
sp|Q6VBA4|HFC1A_ORYSJ Heat stress transcription factor C-1a OS=Oryza sativa subsp. japonica GN=HSFC1A PE=2 SV=2 71 173 2.0E-12
sp|Q84MN7|HFA2A_ORYSJ Heat stress transcription factor A-2a OS=Oryza sativa subsp. japonica GN=HSFA2A PE=2 SV=1 71 170 3.0E-12
sp|Q9FK72|HFA4C_ARATH Heat stress transcription factor A-4c OS=Arabidopsis thaliana GN=HSFA4C PE=2 SV=1 71 258 4.0E-12
sp|Q8GYY1|HSFA3_ARATH Heat stress transcription factor A-3 OS=Arabidopsis thaliana GN=HSFA3 PE=2 SV=2 71 172 4.0E-12
sp|Q9LV52|HSFC1_ARATH Heat stress transcription factor C-1 OS=Arabidopsis thaliana GN=HSFC1 PE=2 SV=1 71 175 4.0E-12
sp|D0VYS2|HSF3_MOUSE Heat shock factor protein 3 OS=Mus musculus GN=Hsf3 PE=2 SV=1 71 171 9.0E-12
sp|Q7XHZ0|HFB4B_ORYSJ Heat stress transcription factor B-4b OS=Oryza sativa subsp. japonica GN=HSFB4B PE=1 SV=1 71 172 1.0E-11
sp|Q5AQ33|HSF_CANAL Heat shock transcription factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTA8 PE=1 SV=1 70 162 1.0E-11
sp|Q9M1V5|HFA7B_ARATH Heat stress transcription factor A-7b OS=Arabidopsis thaliana GN=HSFA7B PE=2 SV=1 46 170 1.0E-11
sp|Q6Z9R8|HFB4A_ORYSJ Putative heat stress transcription factor B-4a OS=Oryza sativa subsp. japonica GN=HSFB4A PE=3 SV=1 71 172 2.0E-11
sp|Q67U94|HFB4C_ORYSJ Heat stress transcription factor B-4c OS=Oryza sativa subsp. japonica GN=HSFB4C PE=3 SV=1 71 170 2.0E-11
sp|Q9SV12|HFA7A_ARATH Heat stress transcription factor A-7a OS=Arabidopsis thaliana GN=HSFA7A PE=2 SV=1 71 170 3.0E-11
sp|Q8H7Y6|HFA2D_ORYSJ Heat stress transcription factor A-2d OS=Oryza sativa subsp. japonica GN=HSFA2D PE=2 SV=2 71 264 4.0E-11
sp|Q338B0|HFA2C_ORYSJ Heat stress transcription factor A-2c OS=Oryza sativa subsp. japonica GN=HSFA2C PE=1 SV=2 71 170 6.0E-11
sp|Q6K6S5|HSFA5_ORYSJ Heat stress transcription factor A-5 OS=Oryza sativa subsp. japonica GN=HSFA5 PE=2 SV=1 71 178 1.0E-10
sp|P53050|MGA1_YEAST Protein MGA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGA1 PE=3 SV=1 63 172 1.0E-10
sp|Q942D6|HFC1B_ORYSJ Heat stress transcription factor C-1b OS=Oryza sativa subsp. japonica GN=HSFC1B PE=2 SV=1 71 173 1.0E-10
sp|Q6H6Q7|HSFA3_ORYSJ Heat stress transcription factor A-3 OS=Oryza sativa subsp. japonica GN=HSFA3 PE=2 SV=1 71 172 4.0E-10
sp|Q10KX8|HFB4D_ORYSJ Heat stress transcription factor B-4d OS=Oryza sativa subsp. japonica GN=HSFB4D PE=3 SV=1 71 170 4.0E-10
sp|O49403|HFA4A_ARATH Heat stress transcription factor A-4a OS=Arabidopsis thaliana GN=HSFA4A PE=2 SV=1 71 263 3.0E-08
sp|Q5Z6A4|HFA6A_ORYSJ Putative heat stress transcription factor A-6a OS=Oryza sativa subsp. japonica GN=HSFA6A PE=3 SV=1 71 132 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0140110 transcription regulator activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0031323 regulation of cellular metabolic process No
GO:0003677 DNA binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6739
MSGSGSGSEAMDLTLHPPAAVRVSEGDTNGKPLTRPAHPSSSEHAASATSSSNAPPAAPAVHQPKIVHTAFIHKL
YNMLEDSTIQHLISWTSNEDSFVVSPSADFSKVLSQYFKHTNISSFVRQLNMYGFHKERDVFHTGSPDTTLWEFK
HGAGNFKRGDLMGLREIKRRASRHALVHREANYNKAPITQPGTPSEPAHMSSDNSDARLANLEHALYDMSARLQR
TEEVAHAANSRSIAVLESANRLFHYNQELMRIITSLVSADSAAYRDVVALQGEVQRHIEGLRTIDESYEGAFGGR
AQYLGVADATPVSPRQLPQDDSRRAGGLTVPQHRGQLQFRPAIAASIIKRPYGSIGGSSSTQSSSPLRNPAPPPP
PGPHPLSNVDPPPENLPRRHTAADISAHGWQPAHSPYPPSNPPSAPWPSSPSRVAPEDQRIRDSLSSYSLQTASH
SRSRPATPPPPPTLALPQMVNGSANNNGSDAFANWSWASSATRDGKSLFARDTSAPPTRRGSMAHILNPSDTAER
SDEDDESRVDDGRKRQRMQ*
Coding >OphauB2|6739
ATGTCCGGCTCTGGTTCTGGCTCGGAAGCCATGGACCTTACCCTTCATCCTCCGGCCGCGGTCCGAGTTTCTGAA
GGCGACACCAACGGCAAGCCCCTCACCAGACCCGCCCACCCGTCGTCATCGGAGCACGCTGCTTCTGCAACCTCG
TCGTCGAATGCGCCGCCTGCCGCTCCCGCCGTCCACCAGCCCAAAATCGTCCATACTGCCTTTATACACAAGCTC
TACAATATGCTAGAAGATAGCACTATACAGCACCTGATATCCTGGACCTCGAATGAGGATAGCTTTGTCGTATCG
CCCTCGGCCGACTTTTCCAAGGTGCTGTCACAATACTTTAAACATACAAACATATCTTCGTTTGTGCGTCAGCTC
AACATGTATGGGTTCCACAAGGAACGAGATGTCTTTCACACGGGCAGCCCGGATACCACGCTGTGGGAGTTCAAG
CACGGAGCCGGCAACTTCAAACGCGGCGATCTCATGGGCCTTCGCGAGATTAAGCGCCGTGCTAGTAGACACGCT
CTGGTACATCGCGAGGCCAACTACAACAAGGCTCCCATTACACAACCCGGCACGCCTTCGGAGCCAGCGCACATG
TCGTCAGACAACTCGGATGCCAGGCTGGCCAACCTTGAACATGCCCTCTACGATATGAGCGCCAGATTACAACGC
ACCGAAGAAGTGGCGCATGCTGCCAACTCGAGGTCTATTGCTGTTTTGGAATCAGCAAACCGGCTATTCCACTAT
AACCAGGAGCTAATGAGGATTATTACCTCGCTCGTCTCAGCCGACAGTGCGGCATACCGTGATGTCGTTGCGCTA
CAAGGCGAGGTGCAGAGACACATTGAGGGGCTACGAACGATTGACGAGTCATATGAAGGTGCCTTTGGCGGCAGA
GCTCAATATCTGGGAGTGGCTGACGCAACGCCGGTATCGCCGCGCCAGCTACCCCAAGACGACTCGAGGCGCGCG
GGCGGCCTGACGGTGCCGCAGCATCGCGGGCAGCTTCAGTTTCGTCCAGCCATTGCGGCCAGCATTATTAAGCGC
CCCTACGGGTCAATTGGTGGAAGCAGCAGCACCCAATCGTCATCGCCTCTGCGCAATCCAGCTCCACCGCCGCCT
CCGGGGCCTCATCCTCTGTCCAACGTTGATCCGCCACCAGAAAATTTGCCTCGGCGGCATACGGCAGCCGACATT
AGCGCCCATGGATGGCAGCCTGCACATTCGCCCTATCCCCCGTCGAACCCGCCCTCTGCGCCCTGGCCCTCGTCG
CCCAGCCGCGTCGCTCCTGAAGACCAACGGATACGCGACTCTCTTTCATCGTATTCGCTACAGACGGCCTCTCAC
TCGCGCTCACGGCCTGCAACTCCGCCGCCACCGCCCACTCTGGCCCTGCCGCAAATGGTGAATGGAAGCGCGAAT
AATAACGGATCCGATGCCTTTGCCAATTGGTCCTGGGCCTCTTCTGCTACCAGGGACGGCAAGAGCCTGTTTGCC
AGAGACACGTCGGCGCCGCCCACACGGCGAGGCAGCATGGCGCATATTTTGAACCCTAGCGACACGGCCGAGCGA
TCAGATGAGGATGATGAGTCTCGGGTCGACGATGGGCGTAAACGCCAGCGCATGCAGTGA
Transcript >OphauB2|6739
ATGTCCGGCTCTGGTTCTGGCTCGGAAGCCATGGACCTTACCCTTCATCCTCCGGCCGCGGTCCGAGTTTCTGAA
GGCGACACCAACGGCAAGCCCCTCACCAGACCCGCCCACCCGTCGTCATCGGAGCACGCTGCTTCTGCAACCTCG
TCGTCGAATGCGCCGCCTGCCGCTCCCGCCGTCCACCAGCCCAAAATCGTCCATACTGCCTTTATACACAAGCTC
TACAATATGCTAGAAGATAGCACTATACAGCACCTGATATCCTGGACCTCGAATGAGGATAGCTTTGTCGTATCG
CCCTCGGCCGACTTTTCCAAGGTGCTGTCACAATACTTTAAACATACAAACATATCTTCGTTTGTGCGTCAGCTC
AACATGTATGGGTTCCACAAGGAACGAGATGTCTTTCACACGGGCAGCCCGGATACCACGCTGTGGGAGTTCAAG
CACGGAGCCGGCAACTTCAAACGCGGCGATCTCATGGGCCTTCGCGAGATTAAGCGCCGTGCTAGTAGACACGCT
CTGGTACATCGCGAGGCCAACTACAACAAGGCTCCCATTACACAACCCGGCACGCCTTCGGAGCCAGCGCACATG
TCGTCAGACAACTCGGATGCCAGGCTGGCCAACCTTGAACATGCCCTCTACGATATGAGCGCCAGATTACAACGC
ACCGAAGAAGTGGCGCATGCTGCCAACTCGAGGTCTATTGCTGTTTTGGAATCAGCAAACCGGCTATTCCACTAT
AACCAGGAGCTAATGAGGATTATTACCTCGCTCGTCTCAGCCGACAGTGCGGCATACCGTGATGTCGTTGCGCTA
CAAGGCGAGGTGCAGAGACACATTGAGGGGCTACGAACGATTGACGAGTCATATGAAGGTGCCTTTGGCGGCAGA
GCTCAATATCTGGGAGTGGCTGACGCAACGCCGGTATCGCCGCGCCAGCTACCCCAAGACGACTCGAGGCGCGCG
GGCGGCCTGACGGTGCCGCAGCATCGCGGGCAGCTTCAGTTTCGTCCAGCCATTGCGGCCAGCATTATTAAGCGC
CCCTACGGGTCAATTGGTGGAAGCAGCAGCACCCAATCGTCATCGCCTCTGCGCAATCCAGCTCCACCGCCGCCT
CCGGGGCCTCATCCTCTGTCCAACGTTGATCCGCCACCAGAAAATTTGCCTCGGCGGCATACGGCAGCCGACATT
AGCGCCCATGGATGGCAGCCTGCACATTCGCCCTATCCCCCGTCGAACCCGCCCTCTGCGCCCTGGCCCTCGTCG
CCCAGCCGCGTCGCTCCTGAAGACCAACGGATACGCGACTCTCTTTCATCGTATTCGCTACAGACGGCCTCTCAC
TCGCGCTCACGGCCTGCAACTCCGCCGCCACCGCCCACTCTGGCCCTGCCGCAAATGGTGAATGGAAGCGCGAAT
AATAACGGATCCGATGCCTTTGCCAATTGGTCCTGGGCCTCTTCTGCTACCAGGGACGGCAAGAGCCTGTTTGCC
AGAGACACGTCGGCGCCGCCCACACGGCGAGGCAGCATGGCGCATATTTTGAACCCTAGCGACACGGCCGAGCGA
TCAGATGAGGATGATGAGTCTCGGGTCGACGATGGGCGTAAACGCCAGCGCATGCAGTGA
Gene >OphauB2|6739
ATGTCCGGCTCTGGTTCTGGCTCGGAAGCCATGGACCTTACCCTTCATCCTCCGGCCGCGGTCCGAGTTTCTGAA
GGCGACACCAACGGCAAGCCCCTCACCAGACCCGCCCACCCGTCGTCATCGGAGCACGCTGCTTCTGCAACCTCG
TCGTCGAATGCGCCGCCTGCCGCTCCCGCCGTCCACCAGCCCAAAATCGTCCATACTGCCTTTATACACAAGCTC
TACAAGTGAGATGTCTCCTCTTTTGCTCGCTGCTTGCCCGTTGGCCAAAGCTGACGCCCTCCCCACCCCCCAAAA
AAGTATGCTAGAAGATAGCACTATACAGCACCTGATATCCTGGACCTCGAATGAGGATAGCTTTGTCGTATCGCC
CTCGGCCGACTTTTCCAAGGTGCTGTCGTAGGTGCCTCCCGATGCGTCATTATGAATGCGCCAAGTTTGTCTCGT
CGTGTTGTCAAGTCTCTCACATGGCCTGTTGCCCTGCAGACAATACTTTAAACATACAAACATATCTTCGTTTGT
GCGTCAGCTCAACATGTATGGGTTCCACAAGGGTAAGCATTGGAAAAGAGTCGTGGGGTGCGCAGTCCCACCTTG
CCAGTGGCTTACGCCGAGGTGCGGTAGAACGAGATGTCTTTCACACGGGCAGCCCGGATACCACGCTGTGGGAGT
TCAAGCACGGAGCCGGCAACTTCAAACGCGGCGATCTCATGGGCCTTCGCGAGATTAAGCGCCGTGCTAGTAGAC
ACGCTCTGGTACATCGCGAGGCCAACTACAACAAGGCTCCCATTACACAACCCGGCACGCCTTCGGAGCCAGCGC
ACATGTCGTCAGACAACTCGGATGCCAGGCTGGCCAACCTTGAACATGCCCTCTACGATATGAGCGCCAGATTAC
AACGCACCGAAGAAGTGGCGCATGCTGCCAACTCGAGGTCTATTGCTGTTTTGGAATCAGCAAACCGGCTATTCC
ACTATAACCAGGAGCTAATGAGGATTATTACCTCGCTCGTCTCAGCCGACAGTGCGGCATACCGTGATGGTGGGT
AGTCAGTCTTGCTCATTTGGGCTGCCGCCGTGCTAACGCCTGTACGCTTAGTCGTTGCGCTACAAGGCGAGGTGC
AGAGACACATTGAGGGGCTACGAACGATTGACGAGTCATATGAAGGTGCCTTTGGCGGCAGAGCTCAATATCTGG
GAGTGGCTGACGCAACGCCGGTATCGCCGCGCCAGCTACCCCAAGACGACTCGAGGCGCGCGGGCGGCCTGACGG
TGCCGCAGCATCGCGGGCAGCTTCAGTTTCGTCCAGCCATTGCGGCCAGCATTATTAAGCGCCCCTACGGGTCAA
TTGGTGGAAGCAGCAGCACCCAATCGTCATCGCCTCTGCGCAATCCAGCTCCACCGCCGCCTCCGGGGCCTCATC
CTCTGTCCAACGTTGATCCGCCACCAGAAAATTTGCCTCGGCGGCATACGGCAGCCGACATTAGCGCCCATGGAT
GGCAGCCTGCACATTCGCCCTATCCCCCGTCGAACCCGCCCTCTGCGCCCTGGCCCTCGTCGCCCAGCCGCGTCG
CTCCTGAAGACCAACGGATACGCGACTCTCTTTCATCGTATTCGCTACAGACGGCCTCTCACTCGCGCTCACGGC
CTGCAACTCCGCCGCCACCGCCCACTCTGGCCCTGCCGCAAATGGTGAATGGAAGCGCGAATAATAACGGATCCG
ATGCCTTTGCCAATTGGTCCTGGGCCTCTTCTGCTACCAGGGACGGCAAGAGCCTGTTTGCCAGAGACACGTCGG
CGCCGCCCACACGGCGAGGCAGCATGGCGCATATTTTGAACCCTAGCGACACGGCCGAGCGATCAGATGAGGATG
ATGAGTCTCGGGTCGACGATGGGCGTAAACGCCAGCGCATGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail