Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6734
Gene name
LocationContig_64:56468..57500
Strand+
Gene length (bp)1032
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5R7D0|COX18_PONAB Mitochondrial inner membrane protein COX18 OS=Pongo abelii GN=COX18 PE=2 SV=1 57 309 4.0E-13
sp|Q8VC74|COX18_MOUSE Mitochondrial inner membrane protein COX18 OS=Mus musculus GN=Cox18 PE=1 SV=5 58 309 4.0E-13
sp|Q8N8Q8|COX18_HUMAN Mitochondrial inner membrane protein COX18 OS=Homo sapiens GN=COX18 PE=2 SV=1 57 309 9.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 62 84 22
3 142 161 19
4 208 230 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6734
MATMISLTRRLAARNAVFTTRPLPPCRKPLARRQFHLGVSILGKSVVWTAKHISAFYHVTGIPWFIMIPLAAVAV
GAVVRLPCSILYYRLRRRREELKPLIDLSCIYNRIKATRKHKNDRIAWDKEVAKLDKESRRDIYKSFGVGHWNFY
LHLTVVPFVIVSEALRKLCGSPGSWLAVQLGLEKGSQGARAAVTRPLFEASLTDGGCLWFPDLTVMDPYFILPLI
CSIVFARQIWARMPRERLLILLGIGNKPEMTSSTTRMVLGRVLGRAIIMTPAIPLALADLPSAVMLFWISSSLVG
DAISSMLRAKYQKRGIELTYKSKVKALKSYIPRDPEPTLIKQK*
Coding >OphauB2|6734
ATGGCCACCATGATATCGCTCACCCGCCGCCTAGCAGCTAGAAACGCAGTGTTTACGACGCGGCCACTGCCGCCG
TGCCGAAAGCCTCTTGCACGACGACAGTTCCATCTAGGAGTGTCCATCTTGGGCAAAAGCGTGGTATGGACCGCC
AAGCACATTTCCGCGTTTTACCATGTGACTGGCATTCCATGGTTCATCATGATCCCGCTCGCCGCCGTTGCTGTT
GGCGCCGTGGTTCGGTTGCCGTGCAGCATACTTTATTACAGACTGAGGAGGCGCCGTGAGGAGCTGAAGCCTCTA
ATCGATTTGTCGTGTATATACAATCGCATCAAGGCTACTCGTAAACACAAAAACGACCGAATAGCATGGGACAAG
GAGGTTGCGAAATTGGACAAGGAGTCACGGCGGGACATTTACAAATCCTTTGGCGTTGGGCACTGGAATTTCTAT
CTTCACCTTACCGTGGTGCCCTTTGTCATAGTTTCTGAGGCGTTGCGCAAACTCTGCGGCTCGCCTGGTTCCTGG
CTGGCGGTGCAACTGGGCCTAGAAAAGGGGTCGCAGGGCGCCAGGGCGGCCGTGACCCGGCCCCTCTTTGAGGCA
TCGCTGACAGACGGTGGATGCCTCTGGTTTCCCGACCTGACGGTTATGGATCCTTATTTCATCCTGCCCCTCATT
TGCTCGATTGTGTTTGCTCGACAAATATGGGCTCGAATGCCGCGAGAGAGGCTACTCATCTTGTTGGGCATAGGC
AACAAGCCTGAAATGACCAGCAGTACAACGCGAATGGTTCTAGGAAGAGTTCTAGGAAGAGCAATTATTATGACA
CCCGCGATCCCCCTCGCCCTTGCAGACCTGCCTAGCGCAGTCATGCTCTTCTGGATTTCTTCTTCCCTCGTCGGT
GACGCCATCTCCTCGATGCTGCGCGCCAAGTACCAAAAGCGAGGAATCGAGTTGACCTATAAGTCAAAAGTTAAA
GCACTCAAGTCATATATCCCACGCGATCCCGAGCCAACCTTGATAAAGCAGAAATGA
Transcript >OphauB2|6734
ATGGCCACCATGATATCGCTCACCCGCCGCCTAGCAGCTAGAAACGCAGTGTTTACGACGCGGCCACTGCCGCCG
TGCCGAAAGCCTCTTGCACGACGACAGTTCCATCTAGGAGTGTCCATCTTGGGCAAAAGCGTGGTATGGACCGCC
AAGCACATTTCCGCGTTTTACCATGTGACTGGCATTCCATGGTTCATCATGATCCCGCTCGCCGCCGTTGCTGTT
GGCGCCGTGGTTCGGTTGCCGTGCAGCATACTTTATTACAGACTGAGGAGGCGCCGTGAGGAGCTGAAGCCTCTA
ATCGATTTGTCGTGTATATACAATCGCATCAAGGCTACTCGTAAACACAAAAACGACCGAATAGCATGGGACAAG
GAGGTTGCGAAATTGGACAAGGAGTCACGGCGGGACATTTACAAATCCTTTGGCGTTGGGCACTGGAATTTCTAT
CTTCACCTTACCGTGGTGCCCTTTGTCATAGTTTCTGAGGCGTTGCGCAAACTCTGCGGCTCGCCTGGTTCCTGG
CTGGCGGTGCAACTGGGCCTAGAAAAGGGGTCGCAGGGCGCCAGGGCGGCCGTGACCCGGCCCCTCTTTGAGGCA
TCGCTGACAGACGGTGGATGCCTCTGGTTTCCCGACCTGACGGTTATGGATCCTTATTTCATCCTGCCCCTCATT
TGCTCGATTGTGTTTGCTCGACAAATATGGGCTCGAATGCCGCGAGAGAGGCTACTCATCTTGTTGGGCATAGGC
AACAAGCCTGAAATGACCAGCAGTACAACGCGAATGGTTCTAGGAAGAGTTCTAGGAAGAGCAATTATTATGACA
CCCGCGATCCCCCTCGCCCTTGCAGACCTGCCTAGCGCAGTCATGCTCTTCTGGATTTCTTCTTCCCTCGTCGGT
GACGCCATCTCCTCGATGCTGCGCGCCAAGTACCAAAAGCGAGGAATCGAGTTGACCTATAAGTCAAAAGTTAAA
GCACTCAAGTCATATATCCCACGCGATCCCGAGCCAACCTTGATAAAGCAGAAATGA
Gene >OphauB2|6734
ATGGCCACCATGATATCGCTCACCCGCCGCCTAGCAGCTAGAAACGCAGTGTTTACGACGCGGCCACTGCCGCCG
TGCCGAAAGCCTCTTGCACGACGACAGTTCCATCTAGGAGTGTCCATCTTGGGCAAAAGCGTGGTATGGACCGCC
AAGCACATTTCCGCGTTTTACCATGTGACTGGCATTCCATGGTTCATCATGATCCCGCTCGCCGCCGTTGCTGTT
GGCGCCGTGGTTCGGTTGCCGTGCAGCATACTTTATTACAGACTGAGGAGGCGCCGTGAGGAGCTGAAGCCTCTA
ATCGATTTGTCGTGTATATACAATCGCATCAAGGCTACTCGTAAACACAAAAACGACCGAATAGCATGGGACAAG
GAGGTTGCGAAATTGGACAAGGAGTCACGGCGGGACATTTACAAATCCTTTGGCGTTGGGCACTGGAATTTCTAT
CTTCACCTTACCGTGGTGCCCTTTGTCATAGTTTCTGAGGCGTTGCGCAAACTCTGCGGCTCGCCTGGTTCCTGG
CTGGCGGTGCAACTGGGCCTAGAAAAGGGGTCGCAGGGCGCCAGGGCGGCCGTGACCCGGCCCCTCTTTGAGGCA
TCGCTGACAGACGGTGGATGCCTCTGGTTTCCCGACCTGACGGTTATGGATCCTTATTTCATCCTGCCCCTCATT
TGCTCGATTGTGTTTGCTCGACAAATATGGGCTCGAATGCCGCGAGAGAGGCTACTCATCTTGTTGGGCATAGGC
AACAAGCCTGAAATGACCAGCAGTACAACGCGAATGGTTCTAGGAAGAGTTCTAGGAAGAGCAATTATTATGACA
CCCGCGATCCCCCTCGCCCTTGCAGACCTGCCTAGCGCAGTCATGCTCTTCTGGATTTCTTCTTCCCTCGTCGGT
GACGCCATCTCCTCGATGCTGCGCGCCAAGTACCAAAAGCGAGGAATCGAGTTGACCTATAAGTCAAAAGTTAAA
GCACTCAAGTCATATATCCCACGCGATCCCGAGCCAACCTTGATAAAGCAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail