Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6728
Gene name
LocationContig_64:38711..40353
Strand-
Gene length (bp)1642
Transcript length (bp)1278
Coding sequence length (bp)1278
Protein length (aa) 426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00155 Aminotran_1_2 Aminotransferase class I and II 5.9E-89 55 420

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00507|AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Got2 PE=1 SV=2 1 423 0.0E+00
sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1 1 423 0.0E+00
sp|Q28F67|AATM_XENTR Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1 19 423 0.0E+00
sp|P08907|AATM_HORSE Aspartate aminotransferase, mitochondrial OS=Equus caballus GN=GOT2 PE=1 SV=1 28 423 0.0E+00
sp|P00506|AATM_PIG Aspartate aminotransferase, mitochondrial OS=Sus scrofa GN=GOT2 PE=1 SV=2 1 423 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00507|AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Got2 PE=1 SV=2 1 423 0.0E+00
sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1 1 423 0.0E+00
sp|Q28F67|AATM_XENTR Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1 19 423 0.0E+00
sp|P08907|AATM_HORSE Aspartate aminotransferase, mitochondrial OS=Equus caballus GN=GOT2 PE=1 SV=1 28 423 0.0E+00
sp|P00506|AATM_PIG Aspartate aminotransferase, mitochondrial OS=Sus scrofa GN=GOT2 PE=1 SV=2 1 423 0.0E+00
sp|P12344|AATM_BOVIN Aspartate aminotransferase, mitochondrial OS=Bos taurus GN=GOT2 PE=1 SV=2 1 423 0.0E+00
sp|Q5REB0|AATM_PONAB Aspartate aminotransferase, mitochondrial OS=Pongo abelii GN=GOT2 PE=2 SV=1 13 423 0.0E+00
sp|P12345|AATM_RABIT Aspartate aminotransferase, mitochondrial OS=Oryctolagus cuniculus GN=GOT2 PE=1 SV=2 1 423 0.0E+00
sp|Q4R559|AATM_MACFA Aspartate aminotransferase, mitochondrial OS=Macaca fascicularis GN=GOT2 PE=2 SV=1 1 423 0.0E+00
sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens GN=GOT2 PE=1 SV=3 1 423 0.0E+00
sp|P00508|AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus GN=GOT2 PE=1 SV=2 31 423 1.0E-179
sp|Q55F21|AATM_DICDI Aspartate aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=aatA PE=3 SV=1 31 423 4.0E-167
sp|O94320|AATM_SCHPO Aspartate aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.01 PE=3 SV=1 7 423 8.0E-162
sp|P46643|AAT1_ARATH Aspartate aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=ASP1 PE=1 SV=1 25 423 1.0E-158
sp|P37833|AATC_ORYSJ Aspartate aminotransferase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os01g0760600 PE=2 SV=1 27 421 8.0E-147
sp|P28734|AATC_DAUCA Aspartate aminotransferase, cytoplasmic OS=Daucus carota PE=2 SV=1 28 421 1.0E-145
sp|P28011|AAT1_MEDSA Aspartate aminotransferase 1 OS=Medicago sativa GN=AAT-1 PE=2 SV=2 35 423 2.0E-144
sp|P46645|AAT2_ARATH Aspartate aminotransferase, cytoplasmic isozyme 1 OS=Arabidopsis thaliana GN=ASP2 PE=1 SV=2 29 421 4.0E-142
sp|P46644|AAT3_ARATH Aspartate aminotransferase 3, chloroplastic OS=Arabidopsis thaliana GN=ASP3 PE=1 SV=1 29 423 1.0E-141
sp|P26563|AATM_LUPAN Aspartate aminotransferase P2, mitochondrial (Fragment) OS=Lupinus angustifolius PE=2 SV=1 29 420 1.0E-137
sp|P46248|AAT5_ARATH Aspartate aminotransferase, chloroplastic OS=Arabidopsis thaliana GN=ASP5 PE=1 SV=2 10 420 5.0E-137
sp|P46646|AAT4_ARATH Aspartate aminotransferase, cytoplasmic isozyme 2 OS=Arabidopsis thaliana GN=ASP4 PE=2 SV=2 28 423 9.0E-135
sp|P00504|AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus GN=GOT1 PE=1 SV=3 27 422 2.0E-133
sp|Q4R5L1|AATC_MACFA Aspartate aminotransferase, cytoplasmic OS=Macaca fascicularis GN=GOT1 PE=2 SV=1 29 422 2.0E-131
sp|P13221|AATC_RAT Aspartate aminotransferase, cytoplasmic OS=Rattus norvegicus GN=Got1 PE=1 SV=3 29 420 1.0E-130
sp|P00503|AATC_PIG Aspartate aminotransferase, cytoplasmic OS=Sus scrofa GN=GOT1 PE=1 SV=3 29 422 1.0E-130
sp|Q5R691|AATC_PONAB Aspartate aminotransferase, cytoplasmic OS=Pongo abelii GN=GOT1 PE=2 SV=1 29 422 4.0E-130
sp|P17174|AATC_HUMAN Aspartate aminotransferase, cytoplasmic OS=Homo sapiens GN=GOT1 PE=1 SV=3 29 422 4.0E-130
sp|A5A6K8|AATC_PANTR Aspartate aminotransferase, cytoplasmic OS=Pan troglodytes GN=GOT1 PE=2 SV=1 29 422 1.0E-129
sp|P08906|AATC_HORSE Aspartate aminotransferase, cytoplasmic OS=Equus caballus GN=GOT1 PE=1 SV=2 27 422 2.0E-129
sp|P05201|AATC_MOUSE Aspartate aminotransferase, cytoplasmic OS=Mus musculus GN=Got1 PE=1 SV=3 29 422 2.0E-129
sp|P33097|AATC_BOVIN Aspartate aminotransferase, cytoplasmic OS=Bos taurus GN=GOT1 PE=1 SV=3 29 422 5.0E-128
sp|Q54SF7|AATC_DICDI Aspartate aminotransferase, cytoplasmic OS=Dictyostelium discoideum GN=aatB PE=3 SV=1 26 420 1.0E-123
sp|P23542|AATC_YEAST Aspartate aminotransferase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAT2 PE=1 SV=3 38 423 4.0E-123
sp|O42652|AATC_SCHPO Aspartate aminotransferase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aat2 PE=3 SV=1 40 420 3.0E-118
sp|P44425|AAT_HAEIN Aspartate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aspC PE=3 SV=1 33 423 5.0E-111
sp|Q22067|AATC_CAEEL Probable aspartate aminotransferase, cytoplasmic OS=Caenorhabditis elegans GN=got-1.2 PE=3 SV=1 29 420 5.0E-110
sp|P00509|AAT_ECOLI Aspartate aminotransferase OS=Escherichia coli (strain K12) GN=aspC PE=1 SV=1 32 423 8.0E-110
sp|Q56114|AAT_SALTI Aspartate aminotransferase OS=Salmonella typhi GN=aspC PE=3 SV=2 32 423 7.0E-108
sp|P58661|AAT_SALTY Aspartate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aspC PE=3 SV=1 32 423 1.0E-107
sp|P72173|AAT_PSEAE Aspartate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aspC PE=3 SV=2 29 423 1.0E-103
sp|P74861|TYRB_SALTY Aromatic-amino-acid aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tyrB PE=3 SV=3 41 423 8.0E-94
sp|P04693|TYRB_ECOLI Aromatic-amino-acid aminotransferase OS=Escherichia coli (strain K12) GN=tyrB PE=1 SV=1 41 423 1.0E-90
sp|P43336|PHHC_PSEAE Aromatic-amino-acid aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phhC PE=3 SV=2 34 423 9.0E-88
sp|P95468|TYRB_PARDE Aromatic-amino-acid aminotransferase OS=Paracoccus denitrificans GN=tyrB PE=1 SV=1 35 423 1.0E-87
sp|Q01802|AATM_YEAST Aspartate aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAT1 PE=1 SV=2 28 420 4.0E-87
sp|O85746|TYRB_KLEPN Tyrosine aminotransferase OS=Klebsiella pneumoniae GN=tyrB PE=1 SV=1 41 423 8.0E-85
sp|Q2T9S8|AATC2_BOVIN Putative aspartate aminotransferase, cytoplasmic 2 OS=Bos taurus GN=GOT1L1 PE=2 SV=1 29 420 6.0E-66
sp|Q02636|ATTY_RHIME Tyrosine aminotransferase OS=Rhizobium meliloti (strain 1021) GN=tatA PE=3 SV=1 36 417 8.0E-62
sp|Q8NHS2|AATC2_HUMAN Putative aspartate aminotransferase, cytoplasmic 2 OS=Homo sapiens GN=GOT1L1 PE=2 SV=2 29 420 8.0E-56
sp|Q7TSV6|AATC2_MOUSE Putative aspartate aminotransferase, cytoplasmic 2 OS=Mus musculus GN=Got1l1 PE=2 SV=1 29 422 2.0E-54
sp|A6UTL8|HIS8_META3 Histidinol-phosphate aminotransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisC PE=3 SV=1 103 312 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0019842 vitamin binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6728
MLSTLRIASVRRAAWHHATLAVAARRASSVWSAVPQGPPAILGITEAFKADKFDKKINLGVGAYRDDQGKPYVLP
SVREAEAKVVNSKLNKEYAGITGVAEFPALAAKLAYGANSPVLDRVAITQSISGTGALRIGAAFIQRFLSGDKKI
YIPTPSWANHRAVFTDAGLKVEQYRYYNKKTIGLDFDGMVADVKAAPKGSVFLLHACAHNPTGVDPTQDQWRQLS
SIVKEKGHFAFFDMAYQGFASGDTDRDAFAVRHFVEQGHQIALCQSFAKNMGLYGERVGAFSLVCADVAEKKRVE
SQLKILIRPMYSNPPIHGARIATEILSNDKLYQQWLAEVKGMADRIITMRGLLKKELEKLGSKHDWSHITRQIGM
FAYTGMTPEEMDKLAKEFSVYATKDGRISVAGITSGNVGRLAEAIYKVKG*
Coding >OphauB2|6728
ATGCTTTCGACGCTACGAATTGCCAGCGTCCGGCGTGCTGCCTGGCATCACGCCACTCTGGCTGTGGCAGCTCGT
CGGGCCAGCTCCGTCTGGAGTGCAGTGCCTCAGGGCCCTCCTGCCATTCTCGGCATCACGGAAGCTTTCAAGGCG
GACAAGTTTGACAAGAAGATCAACCTCGGTGTCGGCGCCTACCGCGATGACCAGGGCAAGCCATATGTCCTCCCC
TCGGTGCGCGAGGCCGAGGCCAAGGTGGTGAACAGCAAGCTTAACAAGGAGTACGCTGGCATCACTGGCGTCGCC
GAGTTTCCCGCTCTGGCGGCCAAGCTTGCCTATGGCGCCAACTCGCCTGTTCTCGACCGAGTGGCCATTACCCAG
TCCATCTCTGGCACTGGTGCCTTGCGCATCGGCGCCGCCTTTATCCAGCGCTTCTTGTCGGGCGACAAGAAGATC
TACATTCCGACTCCGTCGTGGGCCAACCATCGCGCCGTCTTTACCGATGCTGGCCTCAAGGTGGAACAGTACCGC
TACTACAACAAGAAGACGATTGGCCTCGACTTTGACGGCATGGTGGCCGATGTCAAGGCTGCACCCAAGGGCAGC
GTTTTCCTCTTGCACGCTTGCGCTCACAATCCTACCGGTGTCGATCCCACTCAAGACCAATGGCGCCAGCTTTCG
AGCATCGTCAAGGAAAAGGGCCACTTTGCCTTTTTCGACATGGCCTATCAAGGCTTTGCCAGCGGCGACACTGAC
CGTGACGCCTTTGCCGTGCGCCACTTTGTCGAGCAAGGCCACCAAATTGCCCTGTGCCAGTCGTTTGCAAAGAAC
ATGGGTCTCTATGGTGAGCGCGTAGGCGCATTCTCTCTAGTCTGTGCCGACGTTGCCGAGAAGAAGCGCGTCGAG
TCTCAGCTCAAGATTCTCATTCGCCCAATGTACTCGAACCCACCCATCCACGGCGCCCGCATTGCCACGGAGATT
TTGAGCAACGACAAGCTCTACCAGCAGTGGCTCGCCGAGGTCAAGGGCATGGCTGACCGCATCATCACCATGCGC
GGCCTGCTCAAGAAGGAGCTGGAGAAGCTGGGCTCCAAGCACGACTGGTCCCACATTACCCGCCAGATTGGCATG
TTTGCCTACACGGGCATGACGCCCGAGGAGATGGACAAGCTGGCCAAGGAGTTTTCAGTCTATGCCACCAAGGAC
GGTCGCATCTCGGTCGCCGGCATTACTTCTGGCAACGTTGGCCGACTGGCCGAGGCCATTTACAAGGTCAAGGGT
TAA
Transcript >OphauB2|6728
ATGCTTTCGACGCTACGAATTGCCAGCGTCCGGCGTGCTGCCTGGCATCACGCCACTCTGGCTGTGGCAGCTCGT
CGGGCCAGCTCCGTCTGGAGTGCAGTGCCTCAGGGCCCTCCTGCCATTCTCGGCATCACGGAAGCTTTCAAGGCG
GACAAGTTTGACAAGAAGATCAACCTCGGTGTCGGCGCCTACCGCGATGACCAGGGCAAGCCATATGTCCTCCCC
TCGGTGCGCGAGGCCGAGGCCAAGGTGGTGAACAGCAAGCTTAACAAGGAGTACGCTGGCATCACTGGCGTCGCC
GAGTTTCCCGCTCTGGCGGCCAAGCTTGCCTATGGCGCCAACTCGCCTGTTCTCGACCGAGTGGCCATTACCCAG
TCCATCTCTGGCACTGGTGCCTTGCGCATCGGCGCCGCCTTTATCCAGCGCTTCTTGTCGGGCGACAAGAAGATC
TACATTCCGACTCCGTCGTGGGCCAACCATCGCGCCGTCTTTACCGATGCTGGCCTCAAGGTGGAACAGTACCGC
TACTACAACAAGAAGACGATTGGCCTCGACTTTGACGGCATGGTGGCCGATGTCAAGGCTGCACCCAAGGGCAGC
GTTTTCCTCTTGCACGCTTGCGCTCACAATCCTACCGGTGTCGATCCCACTCAAGACCAATGGCGCCAGCTTTCG
AGCATCGTCAAGGAAAAGGGCCACTTTGCCTTTTTCGACATGGCCTATCAAGGCTTTGCCAGCGGCGACACTGAC
CGTGACGCCTTTGCCGTGCGCCACTTTGTCGAGCAAGGCCACCAAATTGCCCTGTGCCAGTCGTTTGCAAAGAAC
ATGGGTCTCTATGGTGAGCGCGTAGGCGCATTCTCTCTAGTCTGTGCCGACGTTGCCGAGAAGAAGCGCGTCGAG
TCTCAGCTCAAGATTCTCATTCGCCCAATGTACTCGAACCCACCCATCCACGGCGCCCGCATTGCCACGGAGATT
TTGAGCAACGACAAGCTCTACCAGCAGTGGCTCGCCGAGGTCAAGGGCATGGCTGACCGCATCATCACCATGCGC
GGCCTGCTCAAGAAGGAGCTGGAGAAGCTGGGCTCCAAGCACGACTGGTCCCACATTACCCGCCAGATTGGCATG
TTTGCCTACACGGGCATGACGCCCGAGGAGATGGACAAGCTGGCCAAGGAGTTTTCAGTCTATGCCACCAAGGAC
GGTCGCATCTCGGTCGCCGGCATTACTTCTGGCAACGTTGGCCGACTGGCCGAGGCCATTTACAAGGTCAAGGGT
TAA
Gene >OphauB2|6728
ATGCTTTCGACGCTACGAATTGCCAGCGTCCGGCGTGCTGCCTGGCATCACGCCACTCTGGCTGTGGCAGCTCGT
CGGGCCAGCTCCGTCTGGAGTGCAGTGCCTCAGGGCCCTCCTGTGTGTCTTGATTGCTTCTTTATGAGTGCTGTG
GCTCCTTGCTGACGTTTGCTTGCTTTTAGGATGTGCGTTGATTGATTTCTGCCGCTTGTTTGTCTTGATTGTTGT
GCTCACCAGGTGCATCTTGTTGCCGTTGCTATAGGCCATTCTCGGTATGCCATTGCTCGGCTCAGCTTGGCAATT
GGACTCTATAGCTGACTTTGGCTTCTCAGGCATCACGGAAGCTTTCAAGGCGGACAAGTTTGACAAGAAGATCAA
CCTCGGTATGGCTTGCTTAGACGCTGTTTGCTAGTGGTCCGCTTGCTCGCTAATAGCTATCCTTTTCGTCCTTGA
CAGGTGTCGGCGCCTACCGCGATGACCAGGGCAAGCCATATGTCCTCCCCTCGGTGCGCGAGGCCGAGGCCAAGG
TGGTGAACAGCAAGCTTAACAAGGAGTACGCTGGCATCACTGGCGTCGCCGAGTTTCCCGCTCTGGCGGCCAAGC
TTGCCTATGGCGCCAACTCGCCTGTTCTCGACCGAGTGGCCATTACCCAGTCCATCTCTGGCACTGGTGCCTTGC
GCATCGGCGCCGCCTTTATCCAGCGCTTCTTGTCGGGCGACAAGAAGATCTACATTCCGACTCCGTCGTGGGCCA
ACCATCGCGCCGTCTTTACCGATGCTGGCCTCAAGGTGGAACAGTACCGCTACTACAACAAGAAGACGATTGGCC
TCGACTTTGACGGCATGGTGGCCGATGTCAAGGCTGCACCCAAGGGCAGCGTTTTCCTCTTGCACGCTTGCGCTC
ACAATCCTACCGGTGTCGATCCCACTCAAGACCAATGGCGCCAGCTTTCGAGCATCGTCAAGGAAAAGGGCCACT
TTGCCTTTTTCGACATGGCCTATCAAGGCTTTGCCAGCGGCGACACTGACCGTGACGCCTTTGCCGTGCGCCACT
TTGTCGAGCAAGGCCACCAAATTGCCCTGTGCCAGTCGTTTGCAAAGAACATGGTGAGGCGTCCAAGTTGCTGCA
TCCTCATTGGAATATGCCTATGTTGCTATGAATGGCTGGGGTTAATTGGGGCAACATTTATAAATAGGGTCTCTA
TGGTGAGCGCGTAGGCGCATTCTCTCTAGTCTGTGCCGACGTTGCCGAGAAGAAGCGCGTCGAGTCTCAGCTCAA
GATTCTCATTCGCCCAATGTACTCGAACCCACCCATCCACGGCGCCCGCATTGCCACGGAGATTTTGAGCAACGA
CAAGCTCTACCAGCAGTGGCTCGCCGAGGTCAAGGGCATGGCTGACCGCATCATCACCATGCGCGGCCTGCTCAA
GAAGGAGCTGGAGAAGCTGGGCTCCAAGCACGACTGGTCCCACATTACCCGCCAGATTGGCATGTTTGCCTACAC
GGGCATGACGCCCGAGGAGATGGACAAGCTGGCCAAGGAGTTTTCAGTCTATGCCACCAAGGACGGTCGCATCTC
GGTCGCCGGCATTACTTCTGGCAACGTTGGCCGACTGGCCGAGGCCATTTACAAGGTCAAGGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail