Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6715
Gene name
LocationContig_64:5095..12959
Strand-
Gene length (bp)7864
Transcript length (bp)6378
Coding sequence length (bp)6378
Protein length (aa) 2126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 4.3E-55 1735 1909
PF00698 Acyl_transf_1 Acyl transferase domain 4.7E-53 350 643
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.0E-37 94 205
PF14765 PS-DH Polyketide synthase dehydratase 1.3E-35 689 856
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 9.2E-25 1 85
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.5E-21 208 327
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 2.9E-18 1574 1709
PF08242 Methyltransf_12 Methyltransferase domain 3.3E-19 1074 1179
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.1E-15 1534 1665
PF13649 Methyltransf_25 Methyltransferase domain 5.4E-11 1073 1177
PF13489 Methyltransf_23 Methyltransferase domain 3.6E-09 1065 1186
PF08241 Methyltransf_11 Methyltransferase domain 1.4E-08 1074 1180
PF13847 Methyltransf_31 Methyltransferase domain 1.1E-07 1071 1185
PF00106 adh_short short chain dehydrogenase 1.1E-05 1737 1891
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 3.5E-06 1433 1496
PF00550 PP-binding Phosphopantetheine attachment site 2.8E-05 2043 2101

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 924 2106 6.0E-134
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 842 6.0E-133
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 792 7.0E-125
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 855 4.0E-120
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 796 5.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 924 2106 6.0E-134
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 842 6.0E-133
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 792 7.0E-125
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 855 4.0E-120
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 796 5.0E-118
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 796 1.0E-116
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1 839 1.0E-97
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1 839 1.0E-97
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1 839 1.0E-97
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 676 1.0E-92
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1 779 4.0E-92
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1 837 5.0E-92
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1 837 5.0E-92
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1 837 5.0E-92
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1 837 5.0E-92
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1 641 6.0E-92
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1 641 7.0E-92
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1 837 2.0E-91
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1 641 9.0E-91
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1 779 3.0E-90
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1 776 1.0E-89
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1 836 2.0E-89
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1 857 4.0E-89
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1 697 4.0E-89
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1 672 1.0E-88
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1 846 1.0E-88
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1 809 1.0E-88
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 672 2.0E-88
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1 836 2.0E-88
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1 838 2.0E-88
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1 781 3.0E-87
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1 809 3.0E-86
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1 836 8.0E-86
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1 836 8.0E-86
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 672 1.0E-85
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1 838 4.0E-85
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1397 2101 6.0E-85
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1397 2101 6.0E-85
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1 808 2.0E-84
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 3 693 4.0E-84
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 842 7.0E-84
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 672 2.0E-83
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1 838 1.0E-82
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1 667 4.0E-82
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1 667 4.0E-82
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1 667 5.0E-82
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1 776 2.0E-81
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1 715 6.0E-81
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1 806 8.0E-81
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1 859 9.0E-81
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1 859 1.0E-80
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1 838 8.0E-80
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1 809 1.0E-79
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 809 3.0E-79
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1 797 3.0E-79
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1 776 6.0E-79
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1 766 9.0E-79
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1 778 7.0E-78
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1 859 2.0E-77
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1 860 2.0E-77
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1 766 7.0E-77
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1 859 6.0E-76
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1 859 9.0E-76
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1 860 6.0E-75
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 1 640 7.0E-75
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 1 640 8.0E-75
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 1 640 8.0E-75
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 2 671 1.0E-74
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1 838 3.0E-74
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1 860 3.0E-74
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1 801 2.0E-73
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1 860 2.0E-73
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1 860 3.0E-73
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1 890 2.0E-72
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 5 671 4.0E-71
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1 797 5.0E-71
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1 890 2.0E-70
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1 853 4.0E-70
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1 890 6.0E-70
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1 778 4.0E-69
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1 821 3.0E-66
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1 621 9.0E-65
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 676 1.0E-63
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1404 1912 1.0E-59
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1408 1920 5.0E-59
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1407 1912 2.0E-56
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1407 1912 2.0E-56
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1407 1912 2.0E-56
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1407 1912 2.0E-56
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1407 1912 2.0E-56
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 329 4.0E-55
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 356 6.0E-55
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1433 1921 1.0E-54
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1510 2122 1.0E-54
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1071 1914 2.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3 338 3.0E-54
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1273 1914 9.0E-54
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 328 3.0E-53
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1432 1907 4.0E-53
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1485 2092 2.0E-52
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1 351 4.0E-51
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 328 1.0E-50
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1445 1912 2.0E-50
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1445 1898 6.0E-50
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 1 252 6.0E-50
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1071 1914 1.0E-49
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1445 1898 2.0E-49
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 327 3.0E-48
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3 338 7.0E-48
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3 329 2.0E-47
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 328 2.0E-46
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1118 2087 1.0E-45
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3 328 1.0E-45
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3 336 3.0E-45
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1415 2112 5.0E-44
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1435 2087 3.0E-43
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1071 2105 4.0E-43
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 6 323 1.0E-41
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1 245 2.0E-40
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1 252 3.0E-40
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1284 2111 2.0E-39
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1402 2109 5.0E-39
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1320 2112 7.0E-39
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 1 196 7.0E-39
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1423 1917 8.0E-39
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1374 2112 1.0E-38
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1304 1941 3.0E-38
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1391 2111 3.0E-37
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1391 2109 4.0E-37
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1297 2105 1.0E-36
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1391 2109 3.0E-36
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1386 2111 5.0E-36
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1391 2109 2.0E-35
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1320 2101 2.0E-35
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1410 2101 5.0E-35
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1320 2101 5.0E-35
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1320 2101 9.0E-35
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 253 1.0E-34
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 280 836 1.0E-34
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1 253 1.0E-34
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1 296 2.0E-34
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1410 2091 5.0E-34
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1365 2091 6.0E-34
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1320 2101 2.0E-33
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1428 2101 2.0E-33
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1433 2109 7.0E-33
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 254 8.0E-33
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1423 1917 1.0E-32
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1429 2101 5.0E-32
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1433 2109 1.0E-31
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1320 2094 1.0E-31
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1320 1709 2.0E-31
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1428 2101 4.0E-31
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1427 1917 1.0E-30
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1027 1331 2.0E-30
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1320 1947 2.0E-30
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1365 1916 3.0E-30
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1735 2109 1.0E-28
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1320 1709 1.0E-28
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 327 890 2.0E-28
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1752 2098 3.0E-28
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 345 809 6.0E-28
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1038 1204 8.0E-26
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1038 1204 1.0E-25
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 335 640 1.0E-24
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1434 1710 3.0E-23
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 1 247 1.0E-22
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 1 247 6.0E-22
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 1 247 6.0E-22
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 1 247 6.0E-22
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1708 1916 8.0E-22
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1730 1916 1.0E-21
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 349 742 1.0E-21
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1434 1718 7.0E-20
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1431 1713 8.0E-20
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 5 248 6.0E-19
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1417 1724 1.0E-18
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1417 1724 1.0E-18
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 1 252 1.0E-18
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1432 1706 3.0E-18
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1722 1910 5.0E-18
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1414 1624 7.0E-18
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 2 248 8.0E-18
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1401 1711 1.0E-17
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 5 248 2.0E-17
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 3 248 2.0E-17
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 2 248 2.0E-17
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 3 248 3.0E-17
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 3 248 5.0E-17
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1485 1717 7.0E-17
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 2 252 1.0E-16
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 5 247 1.0E-16
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1655 1895 2.0E-16
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1736 1895 2.0E-16
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 3 248 2.0E-16
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 2 260 2.0E-16
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 2 211 4.0E-16
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 2 211 9.0E-16
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 349 552 1.0E-15
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 2 211 1.0E-15
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1433 1624 2.0E-15
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1750 1915 3.0E-15
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1750 1915 3.0E-15
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 2 248 3.0E-15
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1485 1717 4.0E-15
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1412 1711 4.0E-15
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1710 1893 6.0E-15
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 5 248 7.0E-15
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 3 211 8.0E-15
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 2 252 9.0E-15
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 2 252 9.0E-15
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1418 1678 1.0E-14
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 3 211 2.0E-14
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 3 248 2.0E-14
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 349 552 2.0E-14
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1412 1711 2.0E-14
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 5 248 3.0E-14
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 349 552 4.0E-14
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 5 248 5.0E-14
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 5 248 5.0E-14
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 5 248 5.0E-14
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 5 248 5.0E-14
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 5 248 5.0E-14
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 5 248 5.0E-14
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 1 247 5.0E-14
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 3 211 6.0E-14
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1010 1204 8.0E-14
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 349 628 8.0E-14
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1010 1204 9.0E-14
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1733 1897 1.0E-13
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1010 1204 1.0E-13
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 348 559 1.0E-13
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1428 1713 1.0E-13
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1750 2101 2.0E-13
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1750 2101 2.0E-13
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1750 2101 2.0E-13
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1010 1204 2.0E-13
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 349 552 3.0E-13
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1010 1204 4.0E-13
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 1 247 5.0E-13
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 1 247 5.0E-13
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 1 247 5.0E-13
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 1 247 5.0E-13
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1725 1915 6.0E-13
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1725 1915 6.0E-13
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1725 1915 6.0E-13
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1071 1204 6.0E-13
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1465 1626 6.0E-13
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1418 1618 7.0E-13
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1071 1204 1.0E-12
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1736 1893 1.0E-12
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1433 1626 1.0E-12
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 3 248 1.0E-12
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 3 211 1.0E-12
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1071 1204 2.0E-12
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1102 1205 2.0E-12
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 348 621 2.0E-12
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 2 248 2.0E-12
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1434 1626 3.0E-12
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 1 248 3.0E-12
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 1 248 3.0E-12
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 1 248 3.0E-12
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 1 248 3.0E-12
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1687 1893 4.0E-12
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1431 1711 4.0E-12
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1434 1680 5.0E-12
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1071 1204 6.0E-12
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1693 1917 7.0E-12
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1693 1917 7.0E-12
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1465 1626 7.0E-12
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1693 1917 8.0E-12
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1749 1913 1.0E-11
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 349 621 1.0E-11
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1434 1626 1.0E-11
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 1 251 1.0E-11
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1071 1205 2.0E-11
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1418 1713 2.0E-11
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1432 1626 2.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1736 1896 3.0E-11
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 1 248 3.0E-11
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 349 709 3.0E-11
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1010 1204 5.0E-11
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 2 252 5.0E-11
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 2 252 6.0E-11
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 2 252 7.0E-11
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1720 1907 8.0E-11
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 53 252 9.0E-11
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1434 1626 3.0E-10
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1794 2121 4.0E-10
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1465 1713 6.0E-10
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1035 1204 1.0E-09
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1071 1204 1.0E-09
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 3 210 1.0E-09
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 2 247 1.0E-09
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 54 252 1.0E-09
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1036 1204 1.0E-08
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1071 1204 2.0E-08
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 53 252 3.0E-08
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 979 1204 4.0E-08
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1417 1711 4.0E-08
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1794 2090 8.0E-08
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1729 1907 1.0E-07
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1074 1204 2.0E-07
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 1730 1908 4.0E-07
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1071 1204 7.0E-07
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1071 1204 9.0E-07
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1733 1894 1.0E-06
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 348 520 1.0E-06
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 348 520 1.0E-06
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 1737 2001 1.0E-06
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 348 520 1.0E-06
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1074 1204 2.0E-06
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 348 520 2.0E-06
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 1737 1908 2.0E-06
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 1737 1903 2.0E-06
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1735 1908 4.0E-06
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1735 1908 4.0E-06
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1735 1908 4.0E-06
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1735 1908 4.0E-06
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1735 1908 4.0E-06
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1735 1908 4.0E-06
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1525 1710 4.0E-06
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 1737 1908 5.0E-06
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 1737 1908 5.0E-06
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1074 1204 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6715
MTIRTACSSSLTAFHKACQGLYNGECSAAIVAGTSLILSPTITLEMTEQGVLSPTGSCKTFDAAADGFVRGEAIN
AVLIKRLDDAVRNKDPIRAVIRSIALNCDGKTAGFTLPNSESQEVVIRKAYEMASLDPSQTRFVECHGTGTAIGD
PLEATAVANVFQEHGTYIGSVKPNCGHSEGAAGITSLIKAVLALEHKVIPPNIHFKNPNPKIPFKNGKIRVPVDV
TPWPKDALARVSISSFGVGGANAHAVMDSASLFGGTQGLGNRHEQSFPWPRLLPISANNADSLRQRAQDVIGYMK
QNPGSVDGVGYTLGIRRQHLPYRTFCIAHQDGSISEIQGVQKRREAPQVVFVFTGQGAQWAGMARDLILTWPSFQ
DSIRKLDDVLQRLEKAPSWTIQETLCDENCAVMIEKAEYAQPLSTAIQIALVDLMTQCGVKPRAVIGHSSGEIAA
AYAAGAITAAEAILISYFRGQAMRIQSQKGGMAVVGLGRDAVAGLLVNGVVVACENSPENVTLSGNRDALLKTLE
KVRTEVPGIFVRELRVDMAYHSAYMREISGATAHVPFYSTVSGQLETVFGASYWKANLEMPVLFSSAMRTLMSDL
HKETLFVEVGSHFTLSSPLRQNFAAYSSISHPYIPTLKRNSASATAVVDTLGQLYMHGYLPNYPWDHRSEFWRES
RISLAWRQMKHPYHELLGFICLEASDLEPTWRNVLRLGAIPWLIDHKVLDDVVFPCTGYIALMGEAIRQITMSDS
YTLRDLIIKSPIVLQDSKDVELVTSMKPVRLTDSQNSSWFDFSISSFNGTSWVQNCVAQGKAAEKPVTQARLRQF
GLNYGPCFQGMSEMRADIQTAAATASLNNEENDWEESGGASLDAHAMTRSVGNGAISGNVVAIAEGGIAAIEILD
AKMSPFEKGQDAQAANSGTAYLKWRPDISFVDPGTLIRPLLDTIAALDPVTGYLANYTSWLRQEKQLMMIGETSI
PEAQQWATLDAESRQHILAQVVKQVYESSSREIASVFDLVRKLFDASVARDMFEGKIHPLQIMLENDGLAQLYNI
CSEAVDYRGFLSLNGYARPYMKVLEIGGGTGAVTEKLLTGLQTSKGVLTFAQYTFTDISSGFFATAQKRFQDFKG
LEYRVLDISRDPEEQGFHLGSYDLIVASNVFHATPCLHETLSNARCLLRPGGHLLMQELVQPSKFSFSRFIMGFL
PGWWLELGEAGFSVSEAVTLDDEMPYQMNGIWIATAVDRCEMQGIEVEWRSIRDAHLVPYQDADTYISTVDLDGP
YFHDVSPTDYKAFMDYLSTLGTGTGILWLTRPCQVECTDPRYGLVIGLARTIRTELSLDFATVELGNLDSATADA
VFSVWNKFYNRSLYVTENFDYESEYVIDHDGLIYIGRYDWFSIADELETVPSSHVPLRLTAKQPRLIDSLSWVQH
ELEEVGADQVEVEIHCTGLNFRDILLCMNIIKCRENEFFGFEAAGVVSRVGSDIQHVNIGDRVMTMSWNCFATRK
VVLGELVVPIPDDLSFEDAATMPISILIHSACGGVGLAAIQICKMLGATIYATVGSEEKAQFLMENFGLCRENIF
DSRSTVFLQDTLRATKGHGVDIVLNSLSGDLLHASWKCVAKYGKMIEIGKRDIFGRAKLAMEPFQDNRTFHAIDL
SGMGVDRPKEIQRLMEECLEYYQQGHIKPIRPINVYSAQTVVDAFRYMQSGRHIGKIIVTLPQDDQEQMPAHKMR
PNLSLAGDCSYLLVGGMGGLGKALAMWMVECGARSLVFFSRSAGTSSEDQAFMAELECEGCCVVAVNGDVGDLAH
VRRAVSAAPKRIAGVLQLSMVLRDLPLLETGHDDWTYVQTPKVKGTWNIHEALETADLDFFILFGSLAGVYGNPG
QASYAAANTFLTSFAQYRQSRNLPCSVVDVGFMEGIGFVSRNPVIKSQAIAAGGFFCQEQDLVDATELSIRSCLD
FNKTPQLSNSNGYCNRGQVVMGLKSSKLLSDPASHVVWKRSLRMSHYSQIGMSNNVIKSYDADFLDLIKSIAADP
RILDGATTREAIVQGIGRILCRFTLHPQENLDGATTLSSMGVDSLVGIEIRNWWQRTLGVNISILHIMNAATVQG
LGKVAIDSLREKYSMKLESKSGGEA*
Coding >OphauB2|6715
ATGACTATCCGGACAGCATGCTCTTCGTCGTTGACAGCGTTTCATAAAGCCTGCCAAGGCCTATACAATGGCGAA
TGCTCCGCCGCGATTGTCGCCGGGACAAGCTTGATTCTAAGTCCAACTATAACGCTAGAAATGACGGAGCAGGGC
GTCCTTTCTCCCACGGGATCTTGCAAGACATTTGATGCTGCGGCAGATGGCTTTGTGCGTGGTGAGGCTATCAAC
GCGGTTCTTATTAAGCGTCTAGACGACGCAGTGCGGAATAAAGACCCAATTCGGGCTGTTATTCGATCGATAGCT
CTCAACTGCGACGGAAAGACGGCAGGCTTCACTCTTCCAAACTCAGAGAGCCAAGAAGTAGTAATCCGAAAAGCC
TACGAGATGGCGAGTCTCGATCCATCTCAGACGCGATTTGTTGAGTGTCACGGCACTGGCACAGCAATCGGAGAC
CCGTTGGAGGCCACGGCCGTGGCAAATGTGTTTCAGGAGCACGGCACGTACATTGGATCGGTTAAACCAAATTGT
GGGCACTCCGAGGGCGCCGCTGGCATCACCAGCCTTATCAAGGCCGTTCTTGCACTTGAGCACAAAGTGATTCCG
CCAAACATTCACTTTAAGAATCCAAACCCCAAGATTCCATTTAAAAACGGAAAGATTAGAGTGCCCGTGGATGTT
ACGCCATGGCCCAAAGACGCTCTTGCCCGCGTCAGCATCAGCTCTTTTGGCGTCGGAGGAGCAAACGCACATGCT
GTGATGGATTCGGCTTCCTTATTTGGAGGCACTCAAGGCCTAGGCAACCGACATGAGCAAAGCTTTCCGTGGCCA
CGGCTGCTCCCGATATCAGCAAACAATGCAGACTCACTTCGGCAGCGGGCACAAGATGTTATTGGATACATGAAG
CAAAATCCTGGTTCCGTCGACGGGGTCGGTTACACATTGGGAATTCGTAGACAACACTTGCCCTATCGAACGTTT
TGCATTGCGCATCAAGATGGCAGCATATCAGAAATCCAGGGTGTTCAGAAACGCCGAGAGGCCCCGCAAGTAGTC
TTTGTTTTCACCGGGCAAGGAGCTCAGTGGGCAGGAATGGCAAGGGATCTCATACTGACGTGGCCGTCTTTCCAA
GATTCTATTCGCAAGCTAGATGATGTTTTGCAACGGCTTGAAAAGGCACCTTCTTGGACGATTCAAGAGACTCTA
TGCGACGAGAATTGCGCAGTTATGATAGAAAAGGCCGAGTATGCGCAGCCACTGTCCACGGCAATCCAGATTGCG
CTTGTCGATTTGATGACCCAGTGCGGTGTGAAGCCAAGAGCTGTCATTGGCCATTCGAGTGGAGAAATCGCCGCT
GCGTACGCCGCTGGTGCCATCACAGCGGCCGAAGCAATTCTCATTAGTTATTTCCGAGGTCAAGCCATGCGAATC
CAGTCGCAAAAAGGTGGCATGGCCGTCGTGGGCTTGGGTCGAGATGCCGTAGCTGGCTTGCTTGTCAACGGCGTC
GTAGTGGCTTGTGAGAACAGCCCCGAGAACGTGACGCTGTCGGGGAATCGAGATGCCCTGCTGAAGACACTCGAA
AAGGTCAGGACCGAGGTCCCGGGCATATTTGTCCGGGAACTGAGAGTTGACATGGCATATCATTCGGCCTATATG
CGCGAGATTTCAGGAGCAACTGCCCATGTCCCTTTTTACTCTACCGTCTCTGGCCAACTTGAAACGGTATTTGGC
GCATCCTATTGGAAGGCCAATTTGGAGATGCCGGTTCTCTTTAGCTCTGCCATGCGGACCCTTATGAGTGATTTG
CACAAGGAAACACTCTTCGTCGAGGTTGGGTCTCATTTTACTCTGAGCAGTCCCCTTCGACAAAACTTTGCAGCC
TATTCGAGCATCTCGCATCCCTATATACCCACACTCAAGAGAAATAGCGCCTCGGCAACCGCAGTCGTCGATACC
TTGGGCCAGCTATACATGCATGGCTACCTGCCTAATTATCCCTGGGACCATAGGTCCGAGTTCTGGAGGGAAAGT
CGCATCTCCCTAGCCTGGAGACAGATGAAGCACCCCTATCACGAGCTTCTAGGCTTCATCTGTTTAGAGGCTAGC
GACTTGGAGCCGACGTGGAGAAATGTTCTTCGACTAGGCGCTATTCCCTGGCTAATCGACCACAAGGTTCTCGAC
GACGTCGTCTTCCCTTGCACCGGCTATATTGCCTTGATGGGGGAGGCTATTCGGCAGATAACCATGTCTGACTCG
TATACTTTACGGGACTTGATCATTAAATCACCCATTGTGCTTCAAGACTCGAAGGATGTCGAGCTTGTCACGTCG
ATGAAGCCTGTGCGGCTGACTGACAGCCAGAATTCGTCCTGGTTCGACTTTAGCATCTCCTCCTTCAACGGCACC
TCGTGGGTGCAAAACTGTGTCGCCCAGGGCAAGGCTGCAGAAAAGCCAGTTACACAAGCGAGACTGCGGCAATTT
GGACTCAACTATGGCCCCTGCTTCCAAGGAATGAGCGAGATGCGTGCCGACATACAGACAGCTGCTGCGACGGCA
TCGCTGAATAATGAAGAGAATGACTGGGAAGAGTCCGGAGGTGCTAGTCTTGACGCTCACGCCATGACACGCTCG
GTTGGCAATGGAGCCATCAGCGGCAACGTCGTGGCCATTGCCGAAGGAGGCATTGCCGCCATTGAAATCCTCGAT
GCCAAAATGTCTCCATTTGAGAAGGGACAAGATGCACAAGCAGCTAATTCGGGCACAGCCTACTTGAAGTGGCGT
CCCGATATTAGCTTTGTCGACCCGGGCACTCTAATACGCCCACTTCTAGATACCATTGCCGCTTTGGATCCTGTG
ACTGGTTATCTGGCCAACTACACCTCCTGGCTTCGGCAAGAGAAGCAACTGATGATGATTGGCGAGACGTCCATT
CCGGAGGCGCAGCAATGGGCTACACTGGATGCAGAATCTCGGCAGCACATCTTGGCTCAAGTTGTGAAACAAGTA
TATGAGTCGTCTAGCCGAGAGATTGCAAGCGTCTTCGACTTGGTGCGCAAGCTTTTTGATGCGAGCGTCGCTCGG
GACATGTTTGAAGGAAAAATACACCCACTGCAAATTATGTTGGAAAATGACGGACTAGCGCAACTTTATAACATT
TGCAGCGAAGCCGTCGACTACCGCGGCTTTCTTTCTTTAAACGGCTATGCTCGACCATATATGAAAGTGCTCGAG
ATTGGAGGGGGAACCGGCGCTGTAACGGAGAAGCTGCTCACTGGCTTACAAACGAGCAAGGGAGTCCTTACCTTT
GCTCAATACACCTTTACCGACATCTCTTCTGGCTTCTTTGCGACCGCCCAGAAACGCTTTCAAGACTTTAAGGGC
TTGGAGTATAGAGTGCTTGATATTTCTAGGGATCCAGAGGAGCAGGGCTTCCATCTCGGCTCCTACGATCTCATT
GTTGCCTCCAACGTCTTTCATGCCACCCCTTGTCTTCACGAGACTCTATCCAACGCCCGTTGCCTGCTTCGCCCC
GGAGGACATCTTTTGATGCAGGAACTGGTTCAACCTTCAAAATTTTCATTTTCTAGGTTCATCATGGGCTTTTTG
CCTGGCTGGTGGCTAGAACTCGGCGAGGCAGGCTTCTCTGTCAGCGAAGCTGTCACCTTGGACGACGAGATGCCA
TACCAAATGAATGGTATTTGGATAGCCACGGCTGTCGACCGCTGCGAGATGCAAGGAATCGAGGTTGAGTGGCGC
TCAATTCGTGATGCCCACCTAGTGCCGTACCAGGACGCCGATACATACATCTCGACAGTTGATTTGGACGGTCCC
TATTTCCACGACGTATCCCCTACAGACTACAAAGCATTCATGGACTATCTTTCGACACTTGGCACTGGCACTGGC
ATTCTTTGGTTGACTCGGCCATGTCAAGTCGAATGTACCGACCCTCGCTACGGTTTAGTGATTGGACTGGCCCGT
ACCATCCGAACCGAGCTTTCATTAGACTTTGCAACTGTTGAACTTGGAAATCTCGACTCGGCTACAGCTGATGCA
GTATTTTCTGTTTGGAACAAATTCTACAATCGTTCTCTTTATGTCACGGAGAATTTCGACTACGAGTCGGAATAT
GTTATAGATCATGACGGTCTTATTTATATTGGGCGCTATGATTGGTTTTCGATTGCTGATGAGCTTGAAACAGTC
CCCAGCAGCCATGTTCCGCTGCGCTTGACTGCTAAACAACCGAGGCTGATTGACTCACTGTCGTGGGTGCAGCAT
GAGTTGGAAGAAGTAGGAGCCGACCAAGTAGAAGTGGAAATCCATTGTACGGGGTTGAATTTTCGGGATATTCTC
CTGTGCATGAACATTATCAAATGCCGAGAAAACGAGTTTTTCGGTTTTGAAGCCGCGGGAGTGGTTTCTCGCGTC
GGCTCGGATATTCAGCACGTCAACATTGGCGATCGCGTCATGACTATGAGTTGGAACTGCTTTGCAACTCGAAAA
GTAGTCCTTGGCGAACTCGTGGTCCCCATACCAGACGACCTGAGTTTTGAAGACGCGGCCACCATGCCAATTTCC
ATCCTGATTCATTCTGCCTGTGGAGGCGTGGGTCTTGCTGCTATTCAAATCTGCAAGATGCTTGGGGCCACTATA
TACGCCACTGTGGGTAGCGAGGAAAAAGCGCAGTTCCTCATGGAAAACTTTGGCCTTTGTCGGGAGAATATCTTT
GACTCTCGCAGCACGGTCTTTCTGCAAGATACTCTCCGAGCAACCAAGGGCCACGGCGTTGACATTGTGCTCAAC
TCTTTGTCTGGAGATCTTCTCCACGCTTCCTGGAAATGCGTTGCCAAGTATGGCAAGATGATTGAGATTGGCAAG
CGCGACATTTTCGGCCGTGCCAAGTTGGCCATGGAGCCATTTCAAGACAACCGGACCTTTCACGCCATTGACCTG
TCAGGCATGGGCGTTGATCGCCCCAAAGAAATACAAAGACTAATGGAAGAGTGTCTTGAATACTACCAACAAGGA
CACATTAAGCCAATTAGGCCGATTAACGTCTATTCTGCGCAGACGGTGGTTGATGCCTTTCGATATATGCAGTCA
GGACGCCATATTGGTAAGATAATCGTCACGCTGCCACAAGACGACCAGGAGCAGATGCCGGCTCACAAGATGCGG
CCAAACTTGTCGCTGGCGGGAGACTGCTCCTATCTCTTGGTTGGAGGCATGGGGGGTCTCGGCAAAGCCCTTGCG
ATGTGGATGGTTGAATGCGGGGCGAGAAGCCTCGTCTTTTTCTCACGCTCTGCAGGGACTAGCAGCGAGGACCAG
GCCTTTATGGCAGAGCTGGAATGTGAGGGCTGCTGCGTCGTTGCAGTGAACGGTGATGTCGGAGACTTGGCCCAT
GTTAGGAGGGCCGTCTCAGCCGCGCCGAAACGCATTGCCGGGGTGTTGCAACTGTCCATGGTGTTGAGGGACCTC
CCACTACTTGAGACTGGCCATGACGACTGGACCTATGTACAGACTCCAAAGGTCAAGGGGACGTGGAATATTCAC
GAGGCCCTGGAAACCGCTGATTTAGACTTTTTCATCCTGTTTGGGTCTTTAGCAGGCGTCTATGGTAACCCCGGC
CAGGCAAGCTATGCAGCAGCCAATACCTTTCTAACAAGTTTTGCGCAATATCGCCAAAGCCGCAACCTCCCGTGC
TCGGTAGTTGACGTTGGATTCATGGAGGGGATAGGATTTGTTAGTCGCAACCCGGTAATAAAGAGCCAGGCGATT
GCTGCTGGAGGATTCTTTTGCCAGGAACAAGACTTGGTTGACGCCACGGAACTAAGCATACGCAGCTGCCTCGAT
TTCAACAAGACGCCTCAGTTGTCCAACAGCAATGGCTACTGCAACCGAGGCCAAGTAGTCATGGGCTTAAAGTCA
TCAAAGCTACTCTCCGACCCAGCCAGCCACGTCGTGTGGAAGCGCAGCCTCCGCATGAGCCACTACTCGCAAATC
GGCATGTCCAACAACGTCATCAAGTCTTACGATGCAGATTTTCTTGACCTCATCAAGTCCATTGCTGCTGACCCC
AGGATACTCGACGGAGCCACTACCCGCGAGGCCATTGTCCAGGGAATAGGCCGTATACTCTGCCGCTTCACCTTG
CACCCACAAGAGAATCTCGACGGGGCCACGACGCTTTCGTCTATGGGCGTTGATTCCCTAGTTGGCATCGAAATA
CGGAATTGGTGGCAGCGGACGCTAGGAGTCAACATTAGCATTCTTCATATCATGAATGCAGCCACCGTGCAGGGG
CTGGGAAAGGTTGCCATTGACTCGCTACGGGAGAAGTATAGTATGAAGCTCGAGTCGAAATCTGGCGGAGAAGCT
TAG
Transcript >OphauB2|6715
ATGACTATCCGGACAGCATGCTCTTCGTCGTTGACAGCGTTTCATAAAGCCTGCCAAGGCCTATACAATGGCGAA
TGCTCCGCCGCGATTGTCGCCGGGACAAGCTTGATTCTAAGTCCAACTATAACGCTAGAAATGACGGAGCAGGGC
GTCCTTTCTCCCACGGGATCTTGCAAGACATTTGATGCTGCGGCAGATGGCTTTGTGCGTGGTGAGGCTATCAAC
GCGGTTCTTATTAAGCGTCTAGACGACGCAGTGCGGAATAAAGACCCAATTCGGGCTGTTATTCGATCGATAGCT
CTCAACTGCGACGGAAAGACGGCAGGCTTCACTCTTCCAAACTCAGAGAGCCAAGAAGTAGTAATCCGAAAAGCC
TACGAGATGGCGAGTCTCGATCCATCTCAGACGCGATTTGTTGAGTGTCACGGCACTGGCACAGCAATCGGAGAC
CCGTTGGAGGCCACGGCCGTGGCAAATGTGTTTCAGGAGCACGGCACGTACATTGGATCGGTTAAACCAAATTGT
GGGCACTCCGAGGGCGCCGCTGGCATCACCAGCCTTATCAAGGCCGTTCTTGCACTTGAGCACAAAGTGATTCCG
CCAAACATTCACTTTAAGAATCCAAACCCCAAGATTCCATTTAAAAACGGAAAGATTAGAGTGCCCGTGGATGTT
ACGCCATGGCCCAAAGACGCTCTTGCCCGCGTCAGCATCAGCTCTTTTGGCGTCGGAGGAGCAAACGCACATGCT
GTGATGGATTCGGCTTCCTTATTTGGAGGCACTCAAGGCCTAGGCAACCGACATGAGCAAAGCTTTCCGTGGCCA
CGGCTGCTCCCGATATCAGCAAACAATGCAGACTCACTTCGGCAGCGGGCACAAGATGTTATTGGATACATGAAG
CAAAATCCTGGTTCCGTCGACGGGGTCGGTTACACATTGGGAATTCGTAGACAACACTTGCCCTATCGAACGTTT
TGCATTGCGCATCAAGATGGCAGCATATCAGAAATCCAGGGTGTTCAGAAACGCCGAGAGGCCCCGCAAGTAGTC
TTTGTTTTCACCGGGCAAGGAGCTCAGTGGGCAGGAATGGCAAGGGATCTCATACTGACGTGGCCGTCTTTCCAA
GATTCTATTCGCAAGCTAGATGATGTTTTGCAACGGCTTGAAAAGGCACCTTCTTGGACGATTCAAGAGACTCTA
TGCGACGAGAATTGCGCAGTTATGATAGAAAAGGCCGAGTATGCGCAGCCACTGTCCACGGCAATCCAGATTGCG
CTTGTCGATTTGATGACCCAGTGCGGTGTGAAGCCAAGAGCTGTCATTGGCCATTCGAGTGGAGAAATCGCCGCT
GCGTACGCCGCTGGTGCCATCACAGCGGCCGAAGCAATTCTCATTAGTTATTTCCGAGGTCAAGCCATGCGAATC
CAGTCGCAAAAAGGTGGCATGGCCGTCGTGGGCTTGGGTCGAGATGCCGTAGCTGGCTTGCTTGTCAACGGCGTC
GTAGTGGCTTGTGAGAACAGCCCCGAGAACGTGACGCTGTCGGGGAATCGAGATGCCCTGCTGAAGACACTCGAA
AAGGTCAGGACCGAGGTCCCGGGCATATTTGTCCGGGAACTGAGAGTTGACATGGCATATCATTCGGCCTATATG
CGCGAGATTTCAGGAGCAACTGCCCATGTCCCTTTTTACTCTACCGTCTCTGGCCAACTTGAAACGGTATTTGGC
GCATCCTATTGGAAGGCCAATTTGGAGATGCCGGTTCTCTTTAGCTCTGCCATGCGGACCCTTATGAGTGATTTG
CACAAGGAAACACTCTTCGTCGAGGTTGGGTCTCATTTTACTCTGAGCAGTCCCCTTCGACAAAACTTTGCAGCC
TATTCGAGCATCTCGCATCCCTATATACCCACACTCAAGAGAAATAGCGCCTCGGCAACCGCAGTCGTCGATACC
TTGGGCCAGCTATACATGCATGGCTACCTGCCTAATTATCCCTGGGACCATAGGTCCGAGTTCTGGAGGGAAAGT
CGCATCTCCCTAGCCTGGAGACAGATGAAGCACCCCTATCACGAGCTTCTAGGCTTCATCTGTTTAGAGGCTAGC
GACTTGGAGCCGACGTGGAGAAATGTTCTTCGACTAGGCGCTATTCCCTGGCTAATCGACCACAAGGTTCTCGAC
GACGTCGTCTTCCCTTGCACCGGCTATATTGCCTTGATGGGGGAGGCTATTCGGCAGATAACCATGTCTGACTCG
TATACTTTACGGGACTTGATCATTAAATCACCCATTGTGCTTCAAGACTCGAAGGATGTCGAGCTTGTCACGTCG
ATGAAGCCTGTGCGGCTGACTGACAGCCAGAATTCGTCCTGGTTCGACTTTAGCATCTCCTCCTTCAACGGCACC
TCGTGGGTGCAAAACTGTGTCGCCCAGGGCAAGGCTGCAGAAAAGCCAGTTACACAAGCGAGACTGCGGCAATTT
GGACTCAACTATGGCCCCTGCTTCCAAGGAATGAGCGAGATGCGTGCCGACATACAGACAGCTGCTGCGACGGCA
TCGCTGAATAATGAAGAGAATGACTGGGAAGAGTCCGGAGGTGCTAGTCTTGACGCTCACGCCATGACACGCTCG
GTTGGCAATGGAGCCATCAGCGGCAACGTCGTGGCCATTGCCGAAGGAGGCATTGCCGCCATTGAAATCCTCGAT
GCCAAAATGTCTCCATTTGAGAAGGGACAAGATGCACAAGCAGCTAATTCGGGCACAGCCTACTTGAAGTGGCGT
CCCGATATTAGCTTTGTCGACCCGGGCACTCTAATACGCCCACTTCTAGATACCATTGCCGCTTTGGATCCTGTG
ACTGGTTATCTGGCCAACTACACCTCCTGGCTTCGGCAAGAGAAGCAACTGATGATGATTGGCGAGACGTCCATT
CCGGAGGCGCAGCAATGGGCTACACTGGATGCAGAATCTCGGCAGCACATCTTGGCTCAAGTTGTGAAACAAGTA
TATGAGTCGTCTAGCCGAGAGATTGCAAGCGTCTTCGACTTGGTGCGCAAGCTTTTTGATGCGAGCGTCGCTCGG
GACATGTTTGAAGGAAAAATACACCCACTGCAAATTATGTTGGAAAATGACGGACTAGCGCAACTTTATAACATT
TGCAGCGAAGCCGTCGACTACCGCGGCTTTCTTTCTTTAAACGGCTATGCTCGACCATATATGAAAGTGCTCGAG
ATTGGAGGGGGAACCGGCGCTGTAACGGAGAAGCTGCTCACTGGCTTACAAACGAGCAAGGGAGTCCTTACCTTT
GCTCAATACACCTTTACCGACATCTCTTCTGGCTTCTTTGCGACCGCCCAGAAACGCTTTCAAGACTTTAAGGGC
TTGGAGTATAGAGTGCTTGATATTTCTAGGGATCCAGAGGAGCAGGGCTTCCATCTCGGCTCCTACGATCTCATT
GTTGCCTCCAACGTCTTTCATGCCACCCCTTGTCTTCACGAGACTCTATCCAACGCCCGTTGCCTGCTTCGCCCC
GGAGGACATCTTTTGATGCAGGAACTGGTTCAACCTTCAAAATTTTCATTTTCTAGGTTCATCATGGGCTTTTTG
CCTGGCTGGTGGCTAGAACTCGGCGAGGCAGGCTTCTCTGTCAGCGAAGCTGTCACCTTGGACGACGAGATGCCA
TACCAAATGAATGGTATTTGGATAGCCACGGCTGTCGACCGCTGCGAGATGCAAGGAATCGAGGTTGAGTGGCGC
TCAATTCGTGATGCCCACCTAGTGCCGTACCAGGACGCCGATACATACATCTCGACAGTTGATTTGGACGGTCCC
TATTTCCACGACGTATCCCCTACAGACTACAAAGCATTCATGGACTATCTTTCGACACTTGGCACTGGCACTGGC
ATTCTTTGGTTGACTCGGCCATGTCAAGTCGAATGTACCGACCCTCGCTACGGTTTAGTGATTGGACTGGCCCGT
ACCATCCGAACCGAGCTTTCATTAGACTTTGCAACTGTTGAACTTGGAAATCTCGACTCGGCTACAGCTGATGCA
GTATTTTCTGTTTGGAACAAATTCTACAATCGTTCTCTTTATGTCACGGAGAATTTCGACTACGAGTCGGAATAT
GTTATAGATCATGACGGTCTTATTTATATTGGGCGCTATGATTGGTTTTCGATTGCTGATGAGCTTGAAACAGTC
CCCAGCAGCCATGTTCCGCTGCGCTTGACTGCTAAACAACCGAGGCTGATTGACTCACTGTCGTGGGTGCAGCAT
GAGTTGGAAGAAGTAGGAGCCGACCAAGTAGAAGTGGAAATCCATTGTACGGGGTTGAATTTTCGGGATATTCTC
CTGTGCATGAACATTATCAAATGCCGAGAAAACGAGTTTTTCGGTTTTGAAGCCGCGGGAGTGGTTTCTCGCGTC
GGCTCGGATATTCAGCACGTCAACATTGGCGATCGCGTCATGACTATGAGTTGGAACTGCTTTGCAACTCGAAAA
GTAGTCCTTGGCGAACTCGTGGTCCCCATACCAGACGACCTGAGTTTTGAAGACGCGGCCACCATGCCAATTTCC
ATCCTGATTCATTCTGCCTGTGGAGGCGTGGGTCTTGCTGCTATTCAAATCTGCAAGATGCTTGGGGCCACTATA
TACGCCACTGTGGGTAGCGAGGAAAAAGCGCAGTTCCTCATGGAAAACTTTGGCCTTTGTCGGGAGAATATCTTT
GACTCTCGCAGCACGGTCTTTCTGCAAGATACTCTCCGAGCAACCAAGGGCCACGGCGTTGACATTGTGCTCAAC
TCTTTGTCTGGAGATCTTCTCCACGCTTCCTGGAAATGCGTTGCCAAGTATGGCAAGATGATTGAGATTGGCAAG
CGCGACATTTTCGGCCGTGCCAAGTTGGCCATGGAGCCATTTCAAGACAACCGGACCTTTCACGCCATTGACCTG
TCAGGCATGGGCGTTGATCGCCCCAAAGAAATACAAAGACTAATGGAAGAGTGTCTTGAATACTACCAACAAGGA
CACATTAAGCCAATTAGGCCGATTAACGTCTATTCTGCGCAGACGGTGGTTGATGCCTTTCGATATATGCAGTCA
GGACGCCATATTGGTAAGATAATCGTCACGCTGCCACAAGACGACCAGGAGCAGATGCCGGCTCACAAGATGCGG
CCAAACTTGTCGCTGGCGGGAGACTGCTCCTATCTCTTGGTTGGAGGCATGGGGGGTCTCGGCAAAGCCCTTGCG
ATGTGGATGGTTGAATGCGGGGCGAGAAGCCTCGTCTTTTTCTCACGCTCTGCAGGGACTAGCAGCGAGGACCAG
GCCTTTATGGCAGAGCTGGAATGTGAGGGCTGCTGCGTCGTTGCAGTGAACGGTGATGTCGGAGACTTGGCCCAT
GTTAGGAGGGCCGTCTCAGCCGCGCCGAAACGCATTGCCGGGGTGTTGCAACTGTCCATGGTGTTGAGGGACCTC
CCACTACTTGAGACTGGCCATGACGACTGGACCTATGTACAGACTCCAAAGGTCAAGGGGACGTGGAATATTCAC
GAGGCCCTGGAAACCGCTGATTTAGACTTTTTCATCCTGTTTGGGTCTTTAGCAGGCGTCTATGGTAACCCCGGC
CAGGCAAGCTATGCAGCAGCCAATACCTTTCTAACAAGTTTTGCGCAATATCGCCAAAGCCGCAACCTCCCGTGC
TCGGTAGTTGACGTTGGATTCATGGAGGGGATAGGATTTGTTAGTCGCAACCCGGTAATAAAGAGCCAGGCGATT
GCTGCTGGAGGATTCTTTTGCCAGGAACAAGACTTGGTTGACGCCACGGAACTAAGCATACGCAGCTGCCTCGAT
TTCAACAAGACGCCTCAGTTGTCCAACAGCAATGGCTACTGCAACCGAGGCCAAGTAGTCATGGGCTTAAAGTCA
TCAAAGCTACTCTCCGACCCAGCCAGCCACGTCGTGTGGAAGCGCAGCCTCCGCATGAGCCACTACTCGCAAATC
GGCATGTCCAACAACGTCATCAAGTCTTACGATGCAGATTTTCTTGACCTCATCAAGTCCATTGCTGCTGACCCC
AGGATACTCGACGGAGCCACTACCCGCGAGGCCATTGTCCAGGGAATAGGCCGTATACTCTGCCGCTTCACCTTG
CACCCACAAGAGAATCTCGACGGGGCCACGACGCTTTCGTCTATGGGCGTTGATTCCCTAGTTGGCATCGAAATA
CGGAATTGGTGGCAGCGGACGCTAGGAGTCAACATTAGCATTCTTCATATCATGAATGCAGCCACCGTGCAGGGG
CTGGGAAAGGTTGCCATTGACTCGCTACGGGAGAAGTATAGTATGAAGCTCGAGTCGAAATCTGGCGGAGAAGCT
TAG
Gene >OphauB2|6715
ATGACTATCCGGACAGCATGCTCTTCGTCGTTGACAGCGTTTCATAAAGCCTGCCAAGGCCTATACAATGGCGAA
TGCTCCGCCGCGATTGTCGCCGGGACAAGCTTGATTCTAAGTCCAACTATAACGCTAGAAATGACGGAGCAGGGC
GTCCTTTCTCCCACGGGATCTTGCAAGACATTTGATGCTGCGGCAGATGGCTTTGTGCGTGGTGAGGCTATCAAC
GCGGTTCTTATTAAGCGTCTAGACGACGCAGTGCGGAATAAAGACCCAATTCGGGCTGTTATTCGATCGATAGCT
CTCAACTGCGACGGAAAGACGGCAGGCTTCACTCTTCCAAACTCAGAGAGCCAAGAAGTAGTAATCCGAAAAGCC
TACGAGATGGCGAGTCTCGATCCATCTCAGACGCGATTTGTTGAGTGTCACGGCACTGGCACAGCAATCGGAGAC
CCGTTGGAGGCCACGGCCGTGGCAAATGTGTTTCAGGAGCACGGCACGTACATTGGATCGGTATGTACGTCTCGT
TTGTTTATTATACATGGCTCTAAAGGGAGGTATAGGTTAAACCAAATTGTGGGCACTCCGAGGGCGCCGCTGGCA
TCACCAGCCTTATCAAGGCCGTTCTTGCACTTGAGCACAAAGTGATTCCGCCAAACATTCACTTTAAGAATCCAA
ACCCCAAGAGTAAGACGACATCTTGAACCAACCGTATAGTCCAAGTGTAGATGGCTAATGAGGAATTCTGTTCTT
TGATGAATAGTTCCATTTAAAAACGGAAAGATTAGAGTGCCCGTGGATGTTACGCCATGGCCCAAAGACGCTCTT
GCCCGCGTCAGCATCAGCTCTTTTGGCGTCGGAGGAGCAAACGCACATGTTTGTCGAGCTCTAGGCCGCGTTTTT
CTCTCCTCTGCCACTAATGCGCTAGATTAGGCTGTGATGGATTCGGCTTCCTTATTTGGAGGCACTCAAGGCCTA
GGCAACCGACATGAGCAAAGCTTTCCGTGGCCACGGCTGCTCCCGATATCAGCAAACAATGCAGACTCACTTCGG
CAGCGGGCACAAGATGTTATTGGATACATGAAGCAAAATCCTGGTTCCGTCGACGGGGTCGGTTACACATTGGGA
ATTCGTAGACAACACTTGCCCTATCGAACGTTTTGCATTGCGCATCAAGATGGCAGCATATCAGAAATCCAGGGT
GTTCAGAAACGCCGAGAGGCCCCGCAAGTAGTCTTTGTTTTCACCGGGCAAGGAGCTCAGTGGGCAGGAATGGCA
AGGGATCTCATACTGACGTGGCCGTCTTTCCAAGATTCTATTCGCAAGCTAGATGATGTTTTGCAACGGCTTGAA
AAGGCACCTTCTTGGACGATTCAAGGCAAGTTGCATTTCTTATCATCCAACCCAGCCAGACTATATGCAAGATGG
CTAACTTATTGGCAACCAGAGACTCTATGCGACGAGAATTGCGCAGTTATGATAGAAAAGGCCGAGTATGCGCAG
CCACTGTCCACGGCAATCCAGATTGCGCTTGTCGATTTGATGACCCAGTGCGGTGTGAAGCCAAGAGCTGTCATT
GGCCATTCGAGTGGAGAAATCGCCGCTGCGTACGCCGCTGGTGCCATCACAGCGGCCGAAGCAATTCTCATTAGT
TATTTCCGAGGTCAAGCCATGCGAATCCAGTCGCAAAAAGGTGGCATGGCCGTCGTGGGCTTGGGTCGAGATGCC
GTAGCTGGCTTGCTTGTCAACGGCGTCGTAGTGGCTTGTGAGAACAGCCCCGAGAACGTGACGCTGTCGGGGAAT
CGAGATGCCCTGCTGAAGACACTCGAAAAGGTCAGGACCGAGGTCCCGGGCATATTTGTCCGGGAACTGAGAGTT
GACATGGCATATCATTCGGGTGAGGGCATCAATCTCTCTGTCTGCTCGGCTACACAAAGCCAAGAGACGCTGACA
TTACTTAGCCTATATGCGCGAGATTTCAGGTGCATATCTAAAGCTAATAGAGCCGCATCTAACCTTGCCAGGAGC
AACTGCCCATGTCCCTTTTTACTCTACCGTCTCTGGCCAACTTGAAACGGTATTTGGCGCATCCTATTGGAAGGC
CAATTTGGAGATGCCGGTTCTCTTTAGCTCTGCCATGCGGACCCTTATGAGTGATTTGCACAAGGAAACACTCTT
CGTCGAGGTTGGGTCTCATTTTACTCTGAGCAGTCCCCTTCGACAAAACTTTGCAGCCTATTCGAGCATCTCGCA
TCCCTATATACCCACACTCAAGAGAAATAGCGCCTCGGCAACCGCAGTCGTCGATACCTTGGGCCAGCTATACAT
GCATGGCTGTGTGATAGATTTCACTTGGCTTCACCCGCCGGTGCCTGTTTTGGTAGACCTGCCTAATTATCCCTG
GGACCATAGGTCCGAGTTCTGGAGGGAAAGTCGCATCTCCCTAGCCTGGAGACAGATGAAGCACCCCTATCACGA
GCTTCTAGGCTTCATCTGTTTAGAGGCTAGCGACTTGGAGCCGACGTGGAGAAATGTTCTTCGACTAGGCGCTAT
TCCCTGGCTAATCGACCACAAGGTTCTCGACGACGTCGTCTTCCCTTGCACCGGCTATATTGCCTTGATGGGGGA
GGCTATTCGGCAGATAACCATGTCTGACTCGTATACTTTACGGGACTTGATCATTAAATCACCCATTGTGCTTCA
AGACTCGAAGGATGTCGAGCTTGTCACGTCGATGAAGCCTGTGCGGCTGACTGACAGCCAGAATTCGTCCTGGTT
CGACTTTAGCATCTCCTCCTTCAACGGCACCTCGTGGGTGCAAAACTGTGTCGCCCAGGGCAAGGCTGCAGAAAA
GCCAGTTACACAAGCGGTAACAAGGAGCTTATATCCGCGCCAGATACCGACAGAGTCCTGGTACCAGAGACTGCG
GCAATTTGGACTCAACTATGGCCCCTGCTTCCAAGGAATGAGCGAGATGCGTGCCGACATACAGACAGCTGCTGC
GACGGCATCGCTGAATAATGAAGAGAATGACTGGGAAGAGTATGCCGTTCACCCCACAACTATTGACTTGTGCCT
GCAGCTGTGTTGCGTGGCCCTATCAAATGGCATTTTTCGGCGCTTGGAGACACTTGTCCTCCCGTCGTCTGTGGG
CCACGTCTCTATTAGGTCCGGAGGTGCTAGTCTTGACGCTCACGCCATGACACGCTCGGTTGGCAATGGAGCCAT
CAGCGGCAACGTCGTGGCCATTGCCGAAGGAGGCATTGCCGCCATTGAAATCCTCGATGCCAAAATGTCTCCATT
TGAGAAGGGACAAGATGCACAAGCAGCTAATTCGGGCACAGCCTACTTGAAGTGGCGTCCCGATATTAGCTTTGT
CGACCCGGGCACTCTAATACGCCCAGTTATCAACAAACGGGACATTTGGCTAATGCTGGACAAACTTTGCTACCT
CGGCATTCTACAGCTTCTAGATACCATTGCCGCTTTGGATCCTGTGACTGGTTATCTGGCCAACTACACCTCCTG
GCTTCGGCAAGAGAAGCAACTGATGATGATTGGCGAGACGTCCATTCCGGAGGCGCAGCAATGGGCTACACTGGA
TGCAGAATCTCGGCAGCACATCTTGGCTCAAGTTGTGAAACAAGTATATGAGTCGTCTAGCCGAGAGATTGCAAG
CGTCTTCGACTTGGTGCGCAAGCTTTTTGATGCGAGCGTCGCTCGGGACATGTTTGAAGGAAAAATACACCCACT
GCAAATTATGTTGGAAAATGACGGACTAGCGCAACTTTATAACATTTGCAGCGAAGCCGTCGACTACCGCGGCTT
TCTTTCTTTAAACGGCTATGCTCGACCATATATGAAAGTGCTCGAGATTGGAGGGGGAACCGGCGCTGTAACGGA
GAAGCTGCTCACTGGCTTACAAACGAGCAAGGGAGTCCTTACCTTTGCTCAATACACCTTTACCGACATCTCTTC
TGGCTTCTTTGCGACCGCCCAGAAACGCTTTCAAGACTTTAAGGGCTTGGAGTATAGAGTGCTTGATATTTCTAG
GGATCCAGAGGAGCAGGGCTTCCATCTCGGCTCCTACGATCTCATTGTTGCCTCCAACGTGCGTGAACTCTGACA
GGCATTAATTAGTTTGCCGCCCCATAGAATGGTGCTGACGTTGCCATGACGCCAGGTCTTTCATGCCACCCCTTG
TCTTCACGAGACTCTATCCAACGCCCGTTGCCTGCTTCGCCCCGGAGGACATCTTTTGATGCAGGAACTGGTTCA
ACGTGAGAACTACTCATTTTCATTCCCTCTTAGAGTCCTAACCAAAGGCTTGTATACGGCAAAGTCACATACTAA
CGCATGGCATACATGTAGCTTCAAAATTTTCATTTTCTAGGTTCATCATGGTGCGCCTCTCTTCTGTGTTCCCTT
TGATGCCTCTATAATCCTAGCTTACTGCGTAACTTGTCTTGATATCGAATGATGGCTAACATTTTCATCAACAGG
GCTTTTTGCCTGGCTGGTGGCTAGGTGAGAATGATGGCCGGAAAGATGTACCATTTGTCTCCATTGAGAGATGGA
ACAAAGAACTCGGCGAGGCAGGCTTCTCTGTCAGCGAAGCTGTCACCTTGGACGACGAGATGCCATACCAAATGA
ATGGTATTTGGATAGCCACGGCTGTCGAGTCGGCCGTACGTGCTAGCAAAGTCATCTTGTTGTACAACAAGACTA
GACATGATTTTGCTCGTCTTGTTGCTAGCCGCTGCGAGATGCAAGGAATCGAGGTTGAGTGGCGCTCAATTCGTG
ATGCCCACCTAGTGCCGTACCAGGACGCCGATACATACATCTCGACAGTTGATTTGGACGGTCCCTATTTCCACG
ACGTATCCCCTACAGACTACAAAGCATTCATGGACTATCTTTCGACACTTGGCACTGGCACTGGCATTCTTTGGT
TGACTCGGCCATGTCAAGTCGAATGTACCGACCCTCGCTACGGTTTAGTGATTGGACTGGCCCGTACCATCCGAA
CCGAGCTTTCATTAGACTTTGCAACTGTTGAACTTGGAAATCTCGACTCGGCTACAGCTGATGCAGTATTTTCTG
TTTGGAACAAATTCTACAATCGTTCTCTTTATGTCACGGAGAATTTCGACTACGAGTCGGAATATGTTATAGATC
ATGACGGTCTTATTTATATTGGGCGCTATGATTGGTTTTCGATTGCTGATGAGCTTGAAACAGTCCCCAGCAGCC
ATGTTCCGCTGCGCTTGACTGCTAAACAACCGAGGCTGATTGACTCACTGTCGTGGGTGCAGCATGAGTTGGAAG
AAGTAGGAGCCGACCAAGTAGAAGTGGAAATCCATTGTACGGGGTTGAATTTTCGGGTAAGAGTCCAACTGCAAC
CACTATTCAATCTCATCTTGCTGCGATTGCCACTCGGTCATAGGAGAGATGTATATCTGACACTTTTTAGGATAT
TCTCCTGTGCATGAACATTATCAAATGCCGAGAAAACGAGTTTTTCGGTTTTGAAGCCGCGGGAGTGGTTTCTCG
CGTCGGCTCGGATATTCAGCACGTCAACATTGGCGATCGCGTCATGACTATGAGTTGGAACTGCTTTGCAACTCG
AAAAGTAGTCCTTGGCGAACTCGTGGTCCCCATACCAGACGACCTGAGTTTTGAAGACGCGGCCACCATGCCAAT
TGTCTACAGTACCGCAATCTGCTGCATTATAACAATAGGACGACTTGAAAGAGGCCAGGTTAGTACATGGAGTGG
AATTACGATTTAGACTCTTTCTCTCTTCTTGCGCTGGCCTCGATTGAAAAGATGATGACAAGTTTTTCAGTCCAT
CCTGATTCATTCTGCCTGTGGAGGCGTGGGTCTTGCTGCTATTCAAATCTGCAAGATGCTTGGGGCCACTGTGAG
TTTAATCCATCCATCTCGACGCTAAAGCCATGACACATGTCCGTTAAGCTGAGCAACTTGGTTAGATATACGCCA
CTGTGGGTAGCGAGGAAAAAGCGCAGTTCCTCATGGAAAACTTTGGCCTTTGTCGGGAGAATATCTTTGACTCTC
GCAGCACGGTCTTTCTGCAAGATACTCTCCGAGCAACCAAGGGCCACGGCGTTGACATTGTGCTCAACTCTTTGT
CTGGAGATCTTCTCCACGCTTCCTGGAAATGCGTTGCCAAGTATGGCAAGATGATTGAGATTGGCAAGCGCGACA
TTTTCGGCCGTGCCAAGTTGGCCATGGAGCCATTTCAAGACAACCGGACCTTTCACGCCATTGACCTGTCAGGCA
TGGGCGTTGATCGCCCCAAAGAAATACAAAGGTGAGTTCCCATGTCAATGCAACTCGAGGGCTGTAGAAAATCTC
ACCCTCCTTGGCAGACTAATGGAAGAGTGTCTTGAATACTACCAACAAGGACACATTAAGCCAATTAGGCCGATT
AACGTCTATTCTGCGCAGACGGTGGTTGATGCCTTTCGATATATGCAGTCAGGACGCCATATTGGTAAGATAATC
GTCACGCTGCCACAAGACGACCAGGAGCAGATGCCGGCTCACAAGATGCGGCCAAACTTGTCGCTGGCGGGAGAC
TGCTCCTATCTCTTGGTTGGAGGCATGGGGGGTCTCGGCAAAGCCCTTGCGATGTGGATGGTTGAATGCGGGGCG
AGAAGCCTCGTCTTTTTCTCACGCTCTGCAGGGACTAGCAGCGAGGACCAGGCCTTTATGGCAGAGCTGGAATGT
GAGGGCTGCTGCGTCGTTGCAGTGAACGGTGATGTCGGAGACTTGGCCCATGTTAGGAGGGCCGTCTCAGCCGCG
CCGAAACGCATTGCCGGGGTGTTGCAACTGTCCATGGTGTTGAGGGTGAGTAGCTATGCTTATAGACCAGACTCA
TCACAAGGAGAGAGCCATGTGAGGATCAGAGTCTAACACATCGCCACTTGATTAGGACCTCCCACTACTTGAGAC
TGGCCATGACGACTGGACCTATGTACAGACTCCAAAGGTCAAGGGGACGTGGAATATTCACGAGGCCCTGGAAAC
CGCTGATTTAGACTTTTTCATCCTGTTTGGGTCTTTAGCAGGCGTCTATGGTAACCCCGGCCAGGCAAGCTATGC
AGCAGCCAATACCTTTCTAACAAGTTTTGCGCAATATCGCCAAAGCCGCAACCTCCCGTGCTCGGTAGTTGACGT
TGGATTCATGGAGGGGATAGGATTTGTTAGTCGCAACCCGGTAATAAAGAGCCAGGCGATTGCTGCTGGAGGATT
CTTTTGCCAGGAACAAGACTTGGTTGACGCCACGGAACTAAGCATACGCAGCTGCCTCGATTTCAACAAGACGCC
TCAGTTGTCCAACAGCAATGGCTACTGCAACCGAGGCCAAGTAGTCATGGGCTTAAAGTCATCAAAGCTACTCTC
CGACCCAGCCAGCCACGTCGTGTGGAAGCGCAGCCTCCGCATGAGCCACTACTCGCAAATCGGCATGTCCAACAA
CGTCATCAAGTCTTACGATGCAGATTTTCTTGACCTCATCAAGTCCATTGCTGCTGACCCCAGGATACTCGACGG
AGCCACTACCCGCGAGGCCATTGTCCAGGGAATAGGCCGTATACTCTGCCGCTTCACCTTGCACCCACAAGAGAA
TCTCGACGGGGCCACGACGCTTTCGTCTATGGGCGTTGATTCCCTAGTTGGCATCGAAATACGGAATTGGTGGCA
GCGGACGCTAGGAGTCAACATTAGCATTCTTCATATCATGAATGCAGCCACCGTGCAGGGGCTGGGAAAGGTTGC
CATTGACTCGCTACGGGAGAAGTATAGTATGAAGCTCGAGTCGAAATCTGGCGGAGAAGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail