Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6710
Gene name
LocationContig_63:101153..103745
Strand+
Gene length (bp)2592
Transcript length (bp)2337
Coding sequence length (bp)2337
Protein length (aa) 779

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00202 Aminotran_3 Aminotransferase class-III 1.5E-16 318 434
PF00202 Aminotran_3 Aminotransferase class-III 2.9E-12 567 664
PF13500 AAA_26 AAA domain 1.3E-14 18 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ZKV8|BIODA_ORYSJ Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica GN=BIO3-BIO1 PE=2 SV=1 16 766 1.0E-137
sp|B0F481|BIODA_ARATH Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=BIO3-BIO1 PE=1 SV=1 70 763 8.0E-121
sp|P44426|BIOA_HAEIN Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioA PE=3 SV=1 318 663 1.0E-34
sp|P45488|BIOA_MYCLE Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium leprae (strain TN) GN=bioA PE=3 SV=1 281 669 1.0E-33
sp|P57379|BIOA_BUCAI Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=bioA PE=3 SV=1 268 664 4.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6ZKV8|BIODA_ORYSJ Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica GN=BIO3-BIO1 PE=2 SV=1 16 766 1.0E-137
sp|B0F481|BIODA_ARATH Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=BIO3-BIO1 PE=1 SV=1 70 763 8.0E-121
sp|P44426|BIOA_HAEIN Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioA PE=3 SV=1 318 663 1.0E-34
sp|P45488|BIOA_MYCLE Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium leprae (strain TN) GN=bioA PE=3 SV=1 281 669 1.0E-33
sp|P57379|BIOA_BUCAI Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=bioA PE=3 SV=1 268 664 4.0E-33
sp|Q89AK4|BIOA_BUCBP Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bioA PE=3 SV=1 269 664 4.0E-33
sp|P53656|BIOA_ESCVU Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Escherichia vulneris GN=bioA PE=3 SV=1 269 672 3.0E-32
sp|P22805|BIOA_LYSSH Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Lysinibacillus sphaericus GN=bioA PE=1 SV=1 315 757 1.0E-31
sp|Q5LEY1|BIOAB_BACFN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=bioB PE=3 SV=1 315 757 2.0E-31
sp|Q64VX4|BIOAB_BACFR Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain YCH46) GN=bioB PE=3 SV=1 315 757 2.0E-31
sp|E1WTS4|BIOAB_BACF6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain 638R) GN=bioB PE=3 SV=1 315 757 2.0E-31
sp|Q8A7T2|BIOAB_BACTN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=bioB PE=3 SV=2 318 757 6.0E-31
sp|P53555|BIOK_BACSU L-Lysine--8-amino-7-oxononanoate transaminase OS=Bacillus subtilis (strain 168) GN=bioK PE=1 SV=1 263 660 1.0E-30
sp|P12677|BIOA_SALTY Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioA PE=3 SV=2 269 669 5.0E-30
sp|P36568|BIOA_SERMA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Serratia marcescens GN=bioA PE=3 SV=1 268 660 2.0E-29
sp|Q9FCC2|BIOA_STRCO Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=bioA PE=3 SV=1 318 667 2.0E-29
sp|Q2FVJ6|BIOA_STAA8 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=bioA PE=3 SV=1 261 661 3.0E-29
sp|Q8K9P0|BIOA_BUCAP Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=bioA PE=3 SV=1 268 664 4.0E-28
sp|B7GHM5|BIOA_ANOFW Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioA PE=3 SV=1 254 661 4.0E-28
sp|P50277|BIOA_YEAST Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO3 PE=3 SV=1 269 672 2.0E-27
sp|P9WQ81|BIOA_MYCTU Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioA PE=1 SV=1 318 669 4.0E-27
sp|P9WQ80|BIOA_MYCTO Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioA PE=3 SV=1 318 669 4.0E-27
sp|P0A4X7|BIOA_MYCBO Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=bioA PE=3 SV=1 318 669 4.0E-27
sp|P12995|BIOA_ECOLI Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Escherichia coli (strain K12) GN=bioA PE=1 SV=2 268 776 6.0E-27
sp|Q74CT9|BIOA_GEOSL Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioA PE=3 SV=1 258 668 6.0E-25
sp|Q58696|BIOA_METJA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=bioA PE=3 SV=2 271 772 2.0E-22
sp|Q9ZKM5|BIOA_HELPJ Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bioA PE=3 SV=1 319 647 2.0E-21
sp|O25627|BIOA_HELPY Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bioA PE=3 SV=1 319 647 2.0E-21
sp|Q728P4|BIOA_DESVH Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=bioA PE=3 SV=1 270 649 4.0E-21
sp|O66557|BIOA_AQUAE Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=bioA PE=3 SV=1 261 772 2.0E-20
sp|E6SRG2|BIOAB_BACT6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / P 36-108) GN=bioB PE=3 SV=1 315 434 8.0E-18
sp|P46395|BIOA_CORGL Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=bioA PE=3 SV=2 318 434 1.0E-17
sp|Q9I700|BAUA_PSEAE Beta-alanine--pyruvate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauA PE=1 SV=1 318 660 8.0E-16
sp|E6SRG2|BIOAB_BACT6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / P 36-108) GN=bioB PE=3 SV=1 510 674 1.0E-13
sp|Q88RB9|DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain KT2440) GN=davT PE=1 SV=1 330 765 2.0E-13
sp|Q01K11|GATP1_ORYSI Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17385 PE=3 SV=1 318 664 5.0E-13
sp|Q7XN11|GATP1_ORYSJ Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=OSL2 PE=1 SV=2 318 664 5.0E-13
sp|A7MIU0|PAT_CROS8 Putrescine aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=patA PE=3 SV=2 315 724 2.0E-12
sp|Q7XN12|GATP2_ORYSJ Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os04g0614500 PE=2 SV=2 318 661 3.0E-12
sp|Q01K12|GATP2_ORYSI Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17384 PE=3 SV=1 318 661 3.0E-12
sp|Q84P53|GATP2_SOLLC Gamma aminobutyrate transaminase 2 OS=Solanum lycopersicum GN=GABA-TP2 PE=1 SV=1 315 661 7.0E-12
sp|P28269|OAPT_PSEPU Omega-amino acid--pyruvate aminotransferase OS=Pseudomonas putida PE=1 SV=1 318 651 1.0E-11
sp|Q6D6Y6|PAT_PECAS Putrescine aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=patA PE=3 SV=1 512 663 2.0E-11
sp|Q94CE5|GATP_ARATH Gamma-aminobutyrate transaminase POP2, mitochondrial OS=Arabidopsis thaliana GN=POP2 PE=1 SV=1 315 661 8.0E-11
sp|P46395|BIOA_CORGL Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=bioA PE=3 SV=2 522 664 2.0E-10
sp|A0PP03|BIOD_MYCUA ATP-dependent dethiobiotin synthetase BioD OS=Mycobacterium ulcerans (strain Agy99) GN=bioD PE=3 SV=1 13 191 2.0E-10
sp|B2HQ91|BIOD_MYCMM ATP-dependent dethiobiotin synthetase BioD OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=bioD PE=3 SV=1 13 191 5.0E-10
sp|Q3YXH0|PAT_SHISS Putrescine aminotransferase OS=Shigella sonnei (strain Ss046) GN=patA PE=3 SV=2 512 688 1.0E-09
sp|Q6ZH29|GATP4_ORYSJ Probable gamma-aminobutyrate transaminase 4 OS=Oryza sativa subsp. japonica GN=GABA-T PE=2 SV=1 318 670 1.0E-09
sp|Q8FDF5|PAT_ECOL6 Putrescine aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=patA PE=3 SV=2 508 663 1.0E-09
sp|B7LZM2|PAT_ECO8A Putrescine aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|A8A4N0|PAT_ECOHS Putrescine aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|Q1R6Q7|PAT_ECOUT Putrescine aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B6I445|PAT_ECOSE Putrescine aminotransferase OS=Escherichia coli (strain SE11) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|A1AFZ3|PAT_ECOK1 Putrescine aminotransferase OS=Escherichia coli O1:K1 / APEC GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B7N0M2|PAT_ECO81 Putrescine aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B5YRB3|PAT_ECO5E Putrescine aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=patA PE=3 SV=1 512 663 2.0E-09
sp|Q8XAN1|PAT_ECO57 Putrescine aminotransferase OS=Escherichia coli O157:H7 GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B7LH08|PAT_ECO55 Putrescine aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B7MB08|PAT_ECO45 Putrescine aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B7UIY0|PAT_ECO27 Putrescine aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=patA PE=3 SV=1 512 663 2.0E-09
sp|A7ZRV6|PAT_ECO24 Putrescine aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|P42588|PAT_ECOLI Putrescine aminotransferase OS=Escherichia coli (strain K12) GN=patA PE=1 SV=2 512 663 2.0E-09
sp|B1XG77|PAT_ECODH Putrescine aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|C4ZQY9|PAT_ECOBW Putrescine aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=patA PE=3 SV=1 512 663 2.0E-09
sp|Q83JJ8|PAT_SHIFL Putrescine aminotransferase OS=Shigella flexneri GN=patA PE=3 SV=5 512 663 2.0E-09
sp|Q0T0J2|PAT_SHIF8 Putrescine aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=patA PE=3 SV=1 512 663 2.0E-09
sp|B1IRP4|PAT_ECOLC Putrescine aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|Q31WW1|PAT_SHIBS Putrescine aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|Q0TD34|PAT_ECOL5 Putrescine aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B7LQF8|PAT_ESCF3 Putrescine aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B1LF65|PAT_ECOSM Putrescine aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=patA PE=3 SV=2 512 663 2.0E-09
sp|B7ND61|PAT_ECOLU Putrescine aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=patA PE=3 SV=2 512 663 3.0E-09
sp|Q2GAF9|BIOD_NOVAD ATP-dependent dethiobiotin synthetase BioD OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=bioD PE=3 SV=1 16 193 3.0E-09
sp|Q53196|Y4UB_RHISN Uncharacterized aminotransferase y4uB OS=Rhizobium sp. (strain NGR234) GN=NGR_a01380 PE=3 SV=1 260 656 3.0E-09
sp|B7NJT8|PAT_ECO7I Putrescine aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=patA PE=3 SV=2 512 663 3.0E-09
sp|Q7VSA0|OAT_BORPE Ornithine aminotransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rocD PE=3 SV=2 521 738 5.0E-09
sp|Q7W1E4|OAT_BORPA Ornithine aminotransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rocD PE=3 SV=3 521 738 5.0E-09
sp|Q7WP51|OAT_BORBR Ornithine aminotransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rocD PE=3 SV=2 521 738 5.0E-09
sp|B4RFX6|BIOD_PHEZH ATP-dependent dethiobiotin synthetase BioD OS=Phenylobacterium zucineum (strain HLK1) GN=bioD PE=3 SV=1 16 213 6.0E-09
sp|Q58131|ARGD_METJA Acetylornithine aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argD PE=3 SV=1 315 666 1.0E-08
sp|Q8ZLX7|PAT_SALTY Putrescine aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=patA PE=3 SV=2 516 724 1.0E-08
sp|B4TVV2|PAT_SALSV Putrescine aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=patA PE=3 SV=1 516 724 1.0E-08
sp|B4T688|PAT_SALNS Putrescine aminotransferase OS=Salmonella newport (strain SL254) GN=patA PE=3 SV=1 516 724 1.0E-08
sp|B5F6B4|PAT_SALA4 Putrescine aminotransferase OS=Salmonella agona (strain SL483) GN=patA PE=3 SV=1 516 724 1.0E-08
sp|A9N5Z8|PAT_SALPB Putrescine aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=patA PE=3 SV=1 516 724 1.0E-08
sp|C0PYZ1|PAT_SALPC Putrescine aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=patA PE=3 SV=2 516 724 2.0E-08
sp|Q57JP1|PAT_SALCH Putrescine aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=patA PE=3 SV=1 516 724 2.0E-08
sp|B5REH5|PAT_SALG2 Putrescine aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=patA PE=3 SV=2 516 724 2.0E-08
sp|B5QZ53|PAT_SALEP Putrescine aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=patA PE=3 SV=2 516 724 2.0E-08
sp|B5FHV3|PAT_SALDC Putrescine aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=patA PE=3 SV=1 516 724 2.0E-08
sp|Q1GT35|BIOD_SPHAL ATP-dependent dethiobiotin synthetase BioD OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=bioD PE=3 SV=1 16 199 2.0E-08
sp|Q255H0|BIOD_CHLFF ATP-dependent dethiobiotin synthetase BioD OS=Chlamydophila felis (strain Fe/C-56) GN=bioD PE=3 SV=1 13 211 2.0E-08
sp|A6TEB2|PAT_KLEP7 Putrescine aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=patA PE=3 SV=2 511 724 3.0E-08
sp|A9MPU4|PAT_SALAR Putrescine aminotransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=patA PE=3 SV=2 516 724 3.0E-08
sp|B5XTY7|PAT_KLEP3 Putrescine aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=patA PE=3 SV=1 511 724 3.0E-08
sp|B8IBW1|BIOD_METNO ATP-dependent dethiobiotin synthetase BioD OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=bioD PE=3 SV=1 18 210 3.0E-08
sp|Q8Z3L9|PAT_SALTI Putrescine aminotransferase OS=Salmonella typhi GN=patA PE=3 SV=2 516 724 4.0E-08
sp|B4TIU6|PAT_SALHS Putrescine aminotransferase OS=Salmonella heidelberg (strain SL476) GN=patA PE=3 SV=1 516 724 4.0E-08
sp|A8APX8|PAT_CITK8 Putrescine aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=patA PE=3 SV=2 512 663 4.0E-08
sp|B5BG29|PAT_SALPK Putrescine aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=patA PE=3 SV=2 516 663 5.0E-08
sp|Q5PC95|PAT_SALPA Putrescine aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=patA PE=3 SV=2 516 663 5.0E-08
sp|O66832|BIOD_AQUAE ATP-dependent dethiobiotin synthetase BioD OS=Aquifex aeolicus (strain VF5) GN=bioD PE=3 SV=1 18 185 1.0E-07
sp|A4F8D5|BIOD_SACEN ATP-dependent dethiobiotin synthetase BioD OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=bioD PE=3 SV=1 13 212 1.0E-07
sp|O34662|YODT_BACSU Uncharacterized aminotransferase YodT OS=Bacillus subtilis (strain 168) GN=yodT PE=3 SV=1 318 661 1.0E-07
sp|B5BA72|ASTC_SALPK Succinylornithine transaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=astC PE=3 SV=1 312 426 2.0E-07
sp|Q5PHC8|ASTC_SALPA Succinylornithine transaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=astC PE=3 SV=1 312 426 2.0E-07
sp|Q321P0|ASTC_SHIBS Succinylornithine transaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=astC PE=3 SV=1 312 439 2.0E-07
sp|B2U3D0|ASTC_SHIB3 Succinylornithine transaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=astC PE=3 SV=1 312 439 2.0E-07
sp|Q8ZPV2|ASTC_SALTY Succinylornithine transaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=astC PE=2 SV=1 312 426 2.0E-07
sp|Q97GH9|ARGD_CLOAB Acetylornithine aminotransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argD PE=3 SV=1 516 669 2.0E-07
sp|B7USC9|ASTC_ECO27 Succinylornithine transaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=astC PE=3 SV=1 318 439 3.0E-07
sp|Q1MR97|BIOD_LAWIP ATP-dependent dethiobiotin synthetase BioD OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=bioD PE=3 SV=1 16 200 3.0E-07
sp|Q1RB45|ASTC_ECOUT Succinylornithine transaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|Q8FGZ9|ASTC_ECOL6 Succinylornithine transaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|Q0TH82|ASTC_ECOL5 Succinylornithine transaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|A1ABS9|ASTC_ECOK1 Succinylornithine transaminase OS=Escherichia coli O1:K1 / APEC GN=astC PE=3 SV=1 312 439 3.0E-07
sp|B7MVM7|ASTC_ECO81 Succinylornithine transaminase OS=Escherichia coli O81 (strain ED1a) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|B7MAV9|ASTC_ECO45 Succinylornithine transaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|Q3Z295|ASTC_SHISS Succinylornithine transaminase OS=Shigella sonnei (strain Ss046) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|A4WEQ6|PAT_ENT38 Putrescine aminotransferase OS=Enterobacter sp. (strain 638) GN=patA PE=3 SV=1 511 663 3.0E-07
sp|B6IBG8|ASTC_ECOSE Succinylornithine transaminase OS=Escherichia coli (strain SE11) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|P77581|ASTC_ECOLI Succinylornithine transaminase OS=Escherichia coli (strain K12) GN=astC PE=1 SV=1 312 439 3.0E-07
sp|B1IPI2|ASTC_ECOLC Succinylornithine transaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|B1XGK9|ASTC_ECODH Succinylornithine transaminase OS=Escherichia coli (strain K12 / DH10B) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|C4ZZA4|ASTC_ECOBW Succinylornithine transaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|B7M1G0|ASTC_ECO8A Succinylornithine transaminase OS=Escherichia coli O8 (strain IAI1) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|A7ZML6|ASTC_ECO24 Succinylornithine transaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=astC PE=3 SV=1 312 439 3.0E-07
sp|B7N584|ASTC_ECOLU Succinylornithine transaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=astC PE=3 SV=1 312 439 4.0E-07
sp|A8A0U0|ASTC_ECOHS Succinylornithine transaminase OS=Escherichia coli O9:H4 (strain HS) GN=astC PE=3 SV=1 312 439 4.0E-07
sp|B7L6M2|ASTC_ECO55 Succinylornithine transaminase OS=Escherichia coli (strain 55989 / EAEC) GN=astC PE=3 SV=1 312 439 4.0E-07
sp|Q57PX9|ASTC_SALCH Succinylornithine transaminase OS=Salmonella choleraesuis (strain SC-B67) GN=astC PE=3 SV=1 312 426 4.0E-07
sp|B7LQ44|ASTC_ESCF3 Succinylornithine transaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=astC PE=3 SV=1 312 439 4.0E-07
sp|B1LDY3|ASTC_ECOSM Succinylornithine transaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=astC PE=3 SV=1 312 439 4.0E-07
sp|B7NT29|ASTC_ECO7I Succinylornithine transaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=astC PE=3 SV=1 312 439 4.0E-07
sp|C0Q6X9|ASTC_SALPC Succinylornithine transaminase OS=Salmonella paratyphi C (strain RKS4594) GN=astC PE=3 SV=1 312 426 5.0E-07
sp|B4TGE0|ASTC_SALHS Succinylornithine transaminase OS=Salmonella heidelberg (strain SL476) GN=astC PE=3 SV=1 312 426 5.0E-07
sp|A9N278|ASTC_SALPB Succinylornithine transaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=astC PE=3 SV=1 312 426 6.0E-07
sp|B4T3Z4|ASTC_SALNS Succinylornithine transaminase OS=Salmonella newport (strain SL254) GN=astC PE=3 SV=1 312 426 6.0E-07
sp|B5RB01|ASTC_SALG2 Succinylornithine transaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=astC PE=3 SV=1 312 426 6.0E-07
sp|B5QWJ0|ASTC_SALEP Succinylornithine transaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=astC PE=3 SV=1 312 426 6.0E-07
sp|B5F846|ASTC_SALA4 Succinylornithine transaminase OS=Salmonella agona (strain SL483) GN=astC PE=3 SV=1 312 426 6.0E-07
sp|B5FJD8|ASTC_SALDC Succinylornithine transaminase OS=Salmonella dublin (strain CT_02021853) GN=astC PE=3 SV=1 312 426 6.0E-07
sp|Q8Z6F9|ASTC_SALTI Succinylornithine transaminase OS=Salmonella typhi GN=astC PE=3 SV=1 312 426 6.0E-07
sp|A1U4A9|BIOD_MARHV ATP-dependent dethiobiotin synthetase BioD OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=bioD PE=3 SV=1 14 212 7.0E-07
sp|P49724|OAT_DROAN Ornithine aminotransferase, mitochondrial OS=Drosophila ananassae GN=Oat PE=1 SV=1 568 664 7.0E-07
sp|Q9Z6L7|BIOD_CHLPN ATP-dependent dethiobiotin synthetase BioD OS=Chlamydia pneumoniae GN=bioD PE=3 SV=1 18 250 8.0E-07
sp|Q8U8T9|BIOD_AGRFC ATP-dependent dethiobiotin synthetase BioD OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=bioD PE=3 SV=1 16 193 8.0E-07
sp|P04181|OAT_HUMAN Ornithine aminotransferase, mitochondrial OS=Homo sapiens GN=OAT PE=1 SV=1 522 664 9.0E-07
sp|Q0BLD2|BIOD_FRATO ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=bioD PE=3 SV=1 16 174 9.0E-07
sp|Q2A2V6|BIOD_FRATH ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=bioD PE=3 SV=1 16 174 9.0E-07
sp|A7NCX0|BIOD_FRATF ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=bioD PE=3 SV=1 16 174 9.0E-07
sp|C1A0S6|BIOD_RHOE4 ATP-dependent dethiobiotin synthetase BioD OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=bioD PE=3 SV=1 13 212 1.0E-06
sp|A0Q635|BIOD_FRATN ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. novicida (strain U112) GN=bioD PE=3 SV=1 16 173 1.0E-06
sp|Q2KXN6|BIOCD_BORA1 Biotin biosynthesis bifunctional protein BioCD OS=Bordetella avium (strain 197N) GN=bioCD PE=3 SV=1 18 211 1.0E-06
sp|Q89RB7|OAT_BRADU Ornithine aminotransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rocD PE=3 SV=1 568 663 2.0E-06
sp|A8AHE0|ASTC_CITK8 Succinylornithine transaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=astC PE=3 SV=1 312 439 2.0E-06
sp|O27392|ARGD_METTH Acetylornithine aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argD PE=3 SV=1 519 669 3.0E-06
sp|B1MBZ5|BIOD_MYCA9 ATP-dependent dethiobiotin synthetase BioD OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=bioD PE=3 SV=1 13 205 3.0E-06
sp|Q577P6|BIOD_BRUAB ATP-dependent dethiobiotin synthetase BioD OS=Brucella abortus biovar 1 (strain 9-941) GN=bioD PE=3 SV=1 18 195 3.0E-06
sp|Q2YKB6|BIOD_BRUA2 ATP-dependent dethiobiotin synthetase BioD OS=Brucella abortus (strain 2308) GN=bioD PE=3 SV=1 18 195 3.0E-06
sp|B2SBF2|BIOD_BRUA1 ATP-dependent dethiobiotin synthetase BioD OS=Brucella abortus (strain S19) GN=bioD PE=3 SV=1 18 195 3.0E-06
sp|Q8YBV9|BIOD_BRUME ATP-dependent dethiobiotin synthetase BioD OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=bioD PE=3 SV=1 18 180 4.0E-06
sp|C0RL24|BIOD_BRUMB ATP-dependent dethiobiotin synthetase BioD OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=bioD PE=3 SV=1 18 180 4.0E-06
sp|P59315|ARGD_BIFLO Acetylornithine aminotransferase OS=Bifidobacterium longum (strain NCC 2705) GN=argD PE=3 SV=1 329 435 4.0E-06
sp|Q49W96|OAT2_STAS1 Ornithine aminotransferase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocD2 PE=3 SV=1 568 656 4.0E-06
sp|P22818|BIOD_LYSSH ATP-dependent dethiobiotin synthetase BioD OS=Lysinibacillus sphaericus GN=bioD PE=3 SV=1 16 165 4.0E-06
sp|B5YQ35|ASTC_ECO5E Succinylornithine transaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=astC PE=3 SV=1 312 439 4.0E-06
sp|Q8X598|ASTC_ECO57 Succinylornithine transaminase OS=Escherichia coli O157:H7 GN=astC PE=3 SV=1 312 439 4.0E-06
sp|A4IXP2|BIOD_FRATW ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=bioD PE=3 SV=1 16 174 4.0E-06
sp|Q5NGB5|BIOD_FRATT ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=bioD PE=1 SV=1 16 174 4.0E-06
sp|B2SGE0|BIOD_FRATM ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=bioD PE=3 SV=1 16 174 4.0E-06
sp|Q14HR7|BIOD_FRAT1 ATP-dependent dethiobiotin synthetase BioD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=bioD PE=3 SV=1 16 174 4.0E-06
sp|Q5KVI4|BIOD_GEOKA ATP-dependent dethiobiotin synthetase BioD OS=Geobacillus kaustophilus (strain HTA426) GN=bioD PE=3 SV=1 20 167 4.0E-06
sp|P04182|OAT_RAT Ornithine aminotransferase, mitochondrial OS=Rattus norvegicus GN=Oat PE=1 SV=1 522 664 4.0E-06
sp|Q8FWG5|BIOD_BRUSU ATP-dependent dethiobiotin synthetase BioD OS=Brucella suis biovar 1 (strain 1330) GN=bioD PE=3 SV=1 18 180 5.0E-06
sp|A9WYH0|BIOD_BRUSI ATP-dependent dethiobiotin synthetase BioD OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=bioD PE=3 SV=1 18 180 5.0E-06
sp|A5VUF9|BIOD_BRUO2 ATP-dependent dethiobiotin synthetase BioD OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=bioD PE=3 SV=1 18 180 5.0E-06
sp|A9MBD4|BIOD_BRUC2 ATP-dependent dethiobiotin synthetase BioD OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=bioD PE=3 SV=1 18 180 5.0E-06
sp|B1WZW5|BIOD_CYAA5 ATP-dependent dethiobiotin synthetase BioD OS=Cyanothece sp. (strain ATCC 51142) GN=bioD PE=3 SV=1 18 168 5.0E-06
sp|P30900|ARGD_RHOCB Acetylornithine aminotransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=argD PE=3 SV=2 524 665 5.0E-06
sp|Q1QJL1|BIOD_NITHX ATP-dependent dethiobiotin synthetase BioD OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=bioD PE=3 SV=1 18 232 5.0E-06
sp|Q130N3|BIOD_RHOPS ATP-dependent dethiobiotin synthetase BioD OS=Rhodopseudomonas palustris (strain BisB5) GN=bioD PE=3 SV=1 18 195 6.0E-06
sp|A6X2S6|BIOD_OCHA4 ATP-dependent dethiobiotin synthetase BioD OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=bioD PE=3 SV=1 16 183 6.0E-06
sp|Q3SPW7|BIOD_NITWN ATP-dependent dethiobiotin synthetase BioD OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=bioD PE=3 SV=1 18 180 7.0E-06
sp|A5FZN7|BIOD_ACICJ ATP-dependent dethiobiotin synthetase BioD OS=Acidiphilium cryptum (strain JF-5) GN=bioD PE=3 SV=1 23 221 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008483 transaminase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0003824 catalytic activity No
GO:0070279 vitamin B6 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0016740 transferase activity No
GO:1901363 heterocyclic compound binding No
GO:0019842 vitamin binding No
GO:0016769 transferase activity, transferring nitrogenous groups No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6710
MTTPLPSVLCRSLHIFQVFGANTAVGKTVCTTLLANTAKRLFRSQQVTFLKPVSTGSPHEADQGHIERFATQVLP
KTLFQYDLAVSPHAAALASGKPVPSDHELLARCRDFITHRAGLGPGWLFVETAGGVHSPAPSGTTQANLYIPLRI
PSILVGDSGLGGISQTIAAFESLHLRGYTVESIVLFQNPCHQNCEFLAQYFNKHHGIPVLGLPAPPVKMQDADCD
ALAMQKYYSHEQCQEVAGKALEQLHNSHEQRLFRLETMATKAHKQIWYPFTQQSLLAPKDIITIDSAHQDSFQTL
LPQCCNQASHEPLLQSSFDGSASWWTQGLGHANPQLTLAAAHAAGRYGHVMFAGAVHEPAMALAETLLQGMASQR
LTRVFFSDNGSTGNEVALKMALRAARLRYGWGAREPIGVLGLRGGYHGDTIGAMDSTEPGAFNQKVEWYEGKGFW
LDYPTILCSNGKWTISTTAEDGSTDQLGTGSSFASLADVFDVESREECGEHKRYELYILGILEQLQREGRRLGAL
ILEPVVLGAGGMRLVDPLFQRTLVKLVRRSAHLFGSCSHGAVEACDWSGLPIIFDEVFTGLYRLGRFSSASFLGV
DADISVHAKLLTGGLVPLCVTLASEAIFGAFGSPDKTDALLHGHSYTAHPVGCQVAVESVRELQAMDRRGAWDWA
QTDGWTRVWSVWPHSLVDRLSRKTSRVVGVWALGSVLAIHLSDGSGTGYGSNAALGLRKALAKQRDSFNIHSRVL
GNVLYLMTGQTTSQSTVKLVADLVNKEF*
Coding >OphauB2|6710
ATGACGACGCCTCTGCCTTCAGTCCTCTGCCGCTCACTGCACATCTTTCAAGTCTTTGGCGCCAACACTGCTGTT
GGCAAGACTGTTTGCACCACCCTACTGGCAAATACTGCCAAGCGCCTCTTTAGAAGCCAGCAAGTGACATTTTTG
AAGCCAGTGTCCACGGGGTCCCCTCATGAGGCTGATCAAGGACACATTGAACGCTTCGCTACCCAAGTCTTGCCC
AAGACGCTCTTTCAATATGACCTTGCCGTCAGTCCGCATGCTGCTGCTCTGGCTTCTGGAAAACCCGTTCCGTCG
GATCACGAGCTTCTCGCAAGATGCCGTGACTTCATCACCCACCGTGCTGGCCTCGGCCCCGGGTGGCTCTTTGTA
GAAACTGCTGGTGGCGTCCACTCTCCGGCTCCGTCTGGTACGACGCAGGCAAACCTGTATATCCCTCTTCGCATC
CCCTCTATTCTCGTTGGTGACTCTGGCCTTGGCGGCATTTCGCAGACAATTGCGGCCTTTGAGTCGCTGCATTTG
CGCGGCTACACTGTTGAGTCGATAGTGCTATTCCAGAACCCTTGTCATCAAAACTGCGAATTCCTTGCCCAATAC
TTCAACAAGCATCATGGCATTCCAGTCCTTGGGTTGCCTGCACCTCCTGTCAAGATGCAGGATGCAGATTGCGAT
GCTCTGGCCATGCAAAAGTATTATAGCCATGAGCAATGTCAAGAGGTTGCCGGCAAAGCGCTTGAGCAGCTCCAT
AATAGCCATGAGCAACGACTCTTCAGACTCGAGACAATGGCTACCAAGGCTCACAAGCAAATATGGTACCCTTTT
ACACAACAGAGCCTCCTCGCCCCCAAGGACATTATAACAATCGACTCGGCGCACCAAGACTCTTTCCAGACTCTG
CTTCCGCAATGCTGCAACCAAGCCTCTCACGAGCCATTGCTGCAGTCCTCCTTTGACGGATCTGCTTCCTGGTGG
ACCCAAGGGCTCGGACATGCCAACCCACAGCTCACTCTGGCCGCTGCCCACGCTGCTGGACGCTATGGCCACGTC
ATGTTTGCCGGTGCTGTGCATGAGCCAGCCATGGCCCTTGCTGAAACTCTTCTTCAAGGCATGGCCAGTCAGCGC
CTCACCCGTGTCTTCTTCTCAGATAATGGAAGTACCGGCAATGAGGTTGCCCTCAAAATGGCATTGCGTGCAGCG
AGGCTGCGCTATGGCTGGGGCGCTCGCGAGCCCATAGGCGTGCTTGGTTTGAGAGGAGGATACCATGGTGACACG
ATTGGTGCTATGGATTCTACCGAGCCTGGTGCCTTTAATCAAAAGGTCGAGTGGTACGAGGGCAAGGGCTTTTGG
CTCGACTATCCAACCATTCTGTGCTCAAACGGCAAGTGGACCATTTCTACTACCGCTGAAGATGGCTCGACGGAC
CAGCTTGGCACAGGCAGCTCTTTTGCTTCCCTCGCCGACGTGTTTGACGTTGAGAGCCGAGAAGAGTGCGGCGAG
CACAAGCGCTACGAATTGTACATTTTGGGTATTCTAGAGCAGCTTCAGAGAGAGGGCCGCAGGCTTGGAGCGCTG
ATTCTCGAGCCCGTGGTGCTCGGCGCTGGGGGCATGAGGCTCGTAGACCCTCTGTTTCAGCGCACTCTTGTCAAG
CTTGTTCGCCGCTCAGCGCATCTCTTTGGCAGCTGTAGCCATGGGGCCGTCGAGGCCTGTGACTGGAGCGGTCTG
CCAATCATTTTTGACGAAGTCTTTACCGGTCTCTATCGTCTTGGTCGCTTCTCGTCGGCATCCTTTCTCGGCGTC
GATGCCGATATCTCTGTTCACGCCAAGCTCTTGACAGGCGGTCTCGTGCCTCTGTGCGTAACGCTGGCGTCTGAA
GCGATATTTGGGGCCTTTGGCAGCCCAGACAAGACGGATGCTCTGCTACACGGGCACAGCTACACTGCCCACCCA
GTTGGCTGCCAGGTGGCGGTGGAATCCGTCCGAGAATTGCAGGCCATGGACCGCCGAGGGGCCTGGGACTGGGCA
CAGACGGACGGCTGGACCCGTGTTTGGTCTGTTTGGCCACACAGCTTGGTCGACAGGCTGTCGAGGAAGACTAGT
CGGGTGGTGGGAGTCTGGGCACTTGGCAGCGTCTTGGCCATTCACCTCAGCGATGGCTCGGGAACTGGCTACGGC
AGCAACGCCGCGCTAGGCTTGCGCAAGGCCTTGGCCAAGCAAAGAGACTCGTTCAACATACACTCGCGAGTCTTG
GGTAATGTGCTGTATCTCATGACGGGGCAGACCACGAGTCAGAGCACCGTCAAACTCGTTGCGGATCTTGTGAAT
AAGGAGTTTTAG
Transcript >OphauB2|6710
ATGACGACGCCTCTGCCTTCAGTCCTCTGCCGCTCACTGCACATCTTTCAAGTCTTTGGCGCCAACACTGCTGTT
GGCAAGACTGTTTGCACCACCCTACTGGCAAATACTGCCAAGCGCCTCTTTAGAAGCCAGCAAGTGACATTTTTG
AAGCCAGTGTCCACGGGGTCCCCTCATGAGGCTGATCAAGGACACATTGAACGCTTCGCTACCCAAGTCTTGCCC
AAGACGCTCTTTCAATATGACCTTGCCGTCAGTCCGCATGCTGCTGCTCTGGCTTCTGGAAAACCCGTTCCGTCG
GATCACGAGCTTCTCGCAAGATGCCGTGACTTCATCACCCACCGTGCTGGCCTCGGCCCCGGGTGGCTCTTTGTA
GAAACTGCTGGTGGCGTCCACTCTCCGGCTCCGTCTGGTACGACGCAGGCAAACCTGTATATCCCTCTTCGCATC
CCCTCTATTCTCGTTGGTGACTCTGGCCTTGGCGGCATTTCGCAGACAATTGCGGCCTTTGAGTCGCTGCATTTG
CGCGGCTACACTGTTGAGTCGATAGTGCTATTCCAGAACCCTTGTCATCAAAACTGCGAATTCCTTGCCCAATAC
TTCAACAAGCATCATGGCATTCCAGTCCTTGGGTTGCCTGCACCTCCTGTCAAGATGCAGGATGCAGATTGCGAT
GCTCTGGCCATGCAAAAGTATTATAGCCATGAGCAATGTCAAGAGGTTGCCGGCAAAGCGCTTGAGCAGCTCCAT
AATAGCCATGAGCAACGACTCTTCAGACTCGAGACAATGGCTACCAAGGCTCACAAGCAAATATGGTACCCTTTT
ACACAACAGAGCCTCCTCGCCCCCAAGGACATTATAACAATCGACTCGGCGCACCAAGACTCTTTCCAGACTCTG
CTTCCGCAATGCTGCAACCAAGCCTCTCACGAGCCATTGCTGCAGTCCTCCTTTGACGGATCTGCTTCCTGGTGG
ACCCAAGGGCTCGGACATGCCAACCCACAGCTCACTCTGGCCGCTGCCCACGCTGCTGGACGCTATGGCCACGTC
ATGTTTGCCGGTGCTGTGCATGAGCCAGCCATGGCCCTTGCTGAAACTCTTCTTCAAGGCATGGCCAGTCAGCGC
CTCACCCGTGTCTTCTTCTCAGATAATGGAAGTACCGGCAATGAGGTTGCCCTCAAAATGGCATTGCGTGCAGCG
AGGCTGCGCTATGGCTGGGGCGCTCGCGAGCCCATAGGCGTGCTTGGTTTGAGAGGAGGATACCATGGTGACACG
ATTGGTGCTATGGATTCTACCGAGCCTGGTGCCTTTAATCAAAAGGTCGAGTGGTACGAGGGCAAGGGCTTTTGG
CTCGACTATCCAACCATTCTGTGCTCAAACGGCAAGTGGACCATTTCTACTACCGCTGAAGATGGCTCGACGGAC
CAGCTTGGCACAGGCAGCTCTTTTGCTTCCCTCGCCGACGTGTTTGACGTTGAGAGCCGAGAAGAGTGCGGCGAG
CACAAGCGCTACGAATTGTACATTTTGGGTATTCTAGAGCAGCTTCAGAGAGAGGGCCGCAGGCTTGGAGCGCTG
ATTCTCGAGCCCGTGGTGCTCGGCGCTGGGGGCATGAGGCTCGTAGACCCTCTGTTTCAGCGCACTCTTGTCAAG
CTTGTTCGCCGCTCAGCGCATCTCTTTGGCAGCTGTAGCCATGGGGCCGTCGAGGCCTGTGACTGGAGCGGTCTG
CCAATCATTTTTGACGAAGTCTTTACCGGTCTCTATCGTCTTGGTCGCTTCTCGTCGGCATCCTTTCTCGGCGTC
GATGCCGATATCTCTGTTCACGCCAAGCTCTTGACAGGCGGTCTCGTGCCTCTGTGCGTAACGCTGGCGTCTGAA
GCGATATTTGGGGCCTTTGGCAGCCCAGACAAGACGGATGCTCTGCTACACGGGCACAGCTACACTGCCCACCCA
GTTGGCTGCCAGGTGGCGGTGGAATCCGTCCGAGAATTGCAGGCCATGGACCGCCGAGGGGCCTGGGACTGGGCA
CAGACGGACGGCTGGACCCGTGTTTGGTCTGTTTGGCCACACAGCTTGGTCGACAGGCTGTCGAGGAAGACTAGT
CGGGTGGTGGGAGTCTGGGCACTTGGCAGCGTCTTGGCCATTCACCTCAGCGATGGCTCGGGAACTGGCTACGGC
AGCAACGCCGCGCTAGGCTTGCGCAAGGCCTTGGCCAAGCAAAGAGACTCGTTCAACATACACTCGCGAGTCTTG
GGTAATGTGCTGTATCTCATGACGGGGCAGACCACGAGTCAGAGCACCGTCAAACTCGTTGCGGATCTTGTGAAT
AAGGAGTTTTAG
Gene >OphauB2|6710
ATGACGACGCCTCTGCCTTCAGTCCTCTGCCGCTCACTGCACATCTTTCAAGTCTTTGGCGCCAACACTGCTGTT
GGCAAGACTGTTTGCACCACCCTACTGGCAAATACTGCCAAGCGCCTCTTTAGAAGCCAGCAAGTGACATTTTTG
AAGCCAGTGTCCACGGGGTCCCCTCATGAGGCTGATCAAGGGTGTAAGCCTGACCCTTTCTCAACTCTAGCTCGC
AATCTATTGACTCGAGTAATACCAGATGAAATATCTACAAATTAGTCCCTTTTTCTTTGCACAAGTTGCTGACAA
TGTTCTTTTCCCCAAAGACACATTGAACGCTTCGCTACCCAAGTCTTGCCCAAGACGCTCTTTCAATATGACCTT
GCCGTCAGTCCGCATGCTGCTGCTCTGGCTTCTGGAAAAGTTGGCACTGCCTTCATCATTGCAATGCAAAGACAC
AAAAAACCCCCACTGACCCATCAACTCAGCCCGTTCCGTCGGATCACGAGCTTCTCGCAAGATGCCGTGACTTCA
TCACCCACCGTGCTGGCCTCGGCCCCGGGTGGCTCTTTGTAGAAACTGCTGGTGGCGTCCACTCTCCGGCTCCGT
CTGGTACGACGCAGGCAAACCTGTATATCCCTCTTCGCATCCCCTCTATTCTCGTTGGTGACTCTGGCCTTGGCG
GCATTTCGCAGACAATTGCGGCCTTTGAGTCGCTGCATTTGCGCGGCTACACTGTTGAGTCGATAGTGCTATTCC
AGAACCCTTGTCATCAAAACTGCGAATTCCTTGCCCAATACTTCAACAAGCATCATGGCATTCCAGTCCTTGGGT
TGCCTGCACCTCCTGTCAAGATGCAGGATGCAGATTGCGATGCTCTGGCCATGCAAAAGTATTATAGCCATGAGC
AATGTCAAGAGGTTGCCGGCAAAGCGCTTGAGCAGCTCCATAATAGCCATGAGCAACGACTCTTCAGACTCGAGA
CAATGGCTACCAAGGCTCACAAGCAAATATGGTACCCTTTTACACAACAGAGCCTCCTCGCCCCCAAGGACATTA
TAACAATCGACTCGGCGCACCAAGACTCTTTCCAGACTCTGCTTCCGCAATGCTGCAACCAAGCCTCTCACGAGC
CATTGCTGCAGTCCTCCTTTGACGGATCTGCTTCCTGGTGGACCCAAGGGCTCGGACATGCCAACCCACAGCTCA
CTCTGGCCGCTGCCCACGCTGCTGGACGCTATGGCCACGTCATGTTTGCCGGTGCTGTGCATGAGCCAGCCATGG
CCCTTGCTGAAACTCTTCTTCAAGGCATGGCCAGTCAGCGCCTCACCCGTGTCTTCTTCTCAGATAATGGAAGTA
CCGGCAATGAGGTTGCCCTCAAAATGGCATTGCGTGCAGCGAGGCTGCGCTATGGCTGGGGCGCTCGCGAGCCCA
TAGGCGTGCTTGGTTTGAGAGGAGGATACCATGGTGACACGATTGGTGCTATGGATTCTACCGAGCCTGGTGCCT
TTAATCAAAAGGTCGAGTGGTACGAGGGCAAGGGCTTTTGGCTCGACTATCCAACCATTCTGTGCTCAAACGGCA
AGTGGACCATTTCTACTACCGCTGAAGATGGCTCGACGGACCAGCTTGGCACAGGCAGCTCTTTTGCTTCCCTCG
CCGACGTGTTTGACGTTGAGAGCCGAGAAGAGTGCGGCGAGCACAAGCGCTACGAATTGTACATTTTGGGTATTC
TAGAGCAGCTTCAGAGAGAGGGCCGCAGGCTTGGAGCGCTGATTCTCGAGCCCGTGGTGCTCGGCGCTGGGGGCA
TGAGGCTCGTGTAAGAAGCCTGGCACATCAGCAATCAAGACGCGACTTCTTTGTATGCTAACTTGTATCGCTAGA
GACCCTCTGTTTCAGCGCACTCTTGTCAAGCTTGTTCGCCGCTCAGCGCATCTCTTTGGCAGCTGTAGCCATGGG
GCCGTCGAGGCCTGTGACTGGAGCGGTCTGCCAATCATTTTTGACGAAGTCTTTACCGGTCTCTATCGTCTTGGT
CGCTTCTCGTCGGCATCCTTTCTCGGCGTCGATGCCGATATCTCTGTTCACGCCAAGCTCTTGACAGGCGGTCTC
GTGCCTCTGTGCGTAACGCTGGCGTCTGAAGCGATATTTGGGGCCTTTGGCAGCCCAGACAAGACGGATGCTCTG
CTACACGGGCACAGCTACACTGCCCACCCAGTTGGCTGCCAGGTGGCGGTGGAATCCGTCCGAGAATTGCAGGCC
ATGGACCGCCGAGGGGCCTGGGACTGGGCACAGACGGACGGCTGGACCCGTGTTTGGTCTGTTTGGCCACACAGC
TTGGTCGACAGGCTGTCGAGGAAGACTAGTCGGGTGGTGGGAGTCTGGGCACTTGGCAGCGTCTTGGCCATTCAC
CTCAGCGATGGCTCGGGAACTGGCTACGGCAGCAACGCCGCGCTAGGCTTGCGCAAGGCCTTGGCCAAGCAAAGA
GACTCGTTCAACATACACTCGCGAGTCTTGGGTAATGTGCTGTATCTCATGACGGGGCAGACCACGAGTCAGAGC
ACCGTCAAACTCGTTGCGGATCTTGTGAATAAGGAGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail