Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|671
Gene name
LocationContig_111:61464..65276
Strand+
Gene length (bp)3812
Transcript length (bp)3186
Coding sequence length (bp)3186
Protein length (aa) 1062

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03810 IBN_N Importin-beta N-terminal domain 6.1E-12 24 97
PF08506 Cse1 Cse1 2.5E-08 347 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59809|IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.11 PE=3 SV=1 12 1030 0.0E+00
sp|P46970|NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD5 PE=1 SV=2 1 1022 6.0E-133
sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens GN=IPO7 PE=1 SV=1 1 1027 3.0E-126
sp|Q9EPL8|IPO7_MOUSE Importin-7 OS=Mus musculus GN=Ipo7 PE=1 SV=2 1 1027 7.0E-126
sp|F4J738|SAD2H_ARATH Importin beta-like SAD2 homolog OS=Arabidopsis thaliana GN=At3g59020 PE=1 SV=1 11 886 1.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59809|IMA3_SCHPO Probable importin c550.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.11 PE=3 SV=1 12 1030 0.0E+00
sp|P46970|NMD5_YEAST Nonsense-mediated mRNA decay protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NMD5 PE=1 SV=2 1 1022 6.0E-133
sp|O95373|IPO7_HUMAN Importin-7 OS=Homo sapiens GN=IPO7 PE=1 SV=1 1 1027 3.0E-126
sp|Q9EPL8|IPO7_MOUSE Importin-7 OS=Mus musculus GN=Ipo7 PE=1 SV=2 1 1027 7.0E-126
sp|F4J738|SAD2H_ARATH Importin beta-like SAD2 homolog OS=Arabidopsis thaliana GN=At3g59020 PE=1 SV=1 11 886 1.0E-118
sp|F4IRR2|SAD2_ARATH Importin beta-like SAD2 OS=Arabidopsis thaliana GN=SAD2 PE=1 SV=1 9 1026 4.0E-114
sp|O15397|IPO8_HUMAN Importin-8 OS=Homo sapiens GN=IPO8 PE=1 SV=2 5 1026 5.0E-110
sp|Q7TMY7|IPO8_MOUSE Importin-8 OS=Mus musculus GN=Ipo8 PE=1 SV=3 1 903 8.0E-110
sp|Q55CX9|IPO7_DICDI Probable importin-7 homolog OS=Dictyostelium discoideum GN=DDB_G0269860 PE=3 SV=1 9 971 1.0E-98
sp|Q04175|SXM1_YEAST Importin beta SMX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SXM1 PE=1 SV=1 5 897 5.0E-93
sp|Q8SR54|IMPO_ENCCU Probable importin ECU10_0620 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU10_0620 PE=1 SV=1 326 903 1.0E-34
sp|Q6GMY9|XPO2_XENLA Exportin-2 OS=Xenopus laevis GN=cse1l PE=2 SV=1 10 476 1.0E-15
sp|P33307|CSE1_YEAST Importin alpha re-exporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSE1 PE=1 SV=2 2 492 2.0E-15
sp|Q8AY73|XPO2_ORENI Exportin-2 OS=Oreochromis niloticus GN=cse1l PE=2 SV=1 9 476 6.0E-13
sp|Q9XZU1|XPO2_DROME Exportin-2 OS=Drosophila melanogaster GN=Cas PE=2 SV=2 6 478 1.0E-12
sp|Q9PTU3|XPO2_PAGMA Exportin-2 OS=Pagrus major GN=cse1l PE=2 SV=1 9 477 2.0E-11
sp|Q7SZC2|XPO2_DANRE Exportin-2 OS=Danio rerio GN=cse1l PE=2 SV=1 10 476 1.0E-10
sp|Q5R9J2|XPO2_PONAB Exportin-2 OS=Pongo abelii GN=CSE1L PE=2 SV=1 10 163 8.0E-08
sp|P55060|XPO2_HUMAN Exportin-2 OS=Homo sapiens GN=CSE1L PE=1 SV=3 10 163 8.0E-08
sp|A5D785|XPO2_BOVIN Exportin-2 OS=Bos taurus GN=CSE1L PE=2 SV=1 10 163 8.0E-08
sp|Q9ERK4|XPO2_MOUSE Exportin-2 OS=Mus musculus GN=Cse1l PE=1 SV=1 10 163 8.0E-08
sp|Q8K2V6|IPO11_MOUSE Importin-11 OS=Mus musculus GN=Ipo11 PE=1 SV=1 11 169 3.0E-06
sp|Q9UI26|IPO11_HUMAN Importin-11 OS=Homo sapiens GN=IPO11 PE=1 SV=1 11 169 5.0E-06
sp|Q02932|KA120_YEAST Importin beta-like protein KAP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAP120 PE=1 SV=1 18 135 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0031267 small GTPase binding Yes
GO:0006886 intracellular protein transport Yes
GO:0033036 macromolecule localization No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0070727 cellular macromolecule localization No
GO:0045184 establishment of protein localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0071702 organic substance transport No
GO:0003674 molecular_function No
GO:0015031 protein transport No
GO:0019899 enzyme binding No
GO:0051179 localization No
GO:0006810 transport No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0051020 GTPase binding No
GO:0051234 establishment of localization No
GO:0008104 protein localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|671
MDTAAIRGLLAASLDTGADNRRRAEIQLKQVEGHPGFMDCLFQIVQAEQDPSVRLSTVIYIKNRVSRSWGASESS
SETLIPEDEKARVREMLVPLLASSQGPVQQQLVPVLQRILQVDFPTRWPRFVDFTAELLNTNDAKSVHAGLHCLL
ALCRTYRYKSAENSDRQQFETIVESTFVRLLAVCNELVNQESTEAGEMLHLALKTYKHATWLELPLCLRQPQANI
AWCTVFLNTVSKTAPAEAMQGEPSDRETHHWWKSKKWAYFNLNRLFIRHGNPTNPGKGDEAAQFAKDFALNIAPE
ILKRYLQEIEKWVAKTSWLSRPCLSYTLGFLDESVRPKEMWTHLKPHLTNLVSHFVFPVLCLNQDDVEEFEDQPV
EYLHRKLNYFEEVSAPDNAATNFLVNLTKNRRKETFEILKFVNAVVNEYEQSPDDKKNHVAKEGALRMIGTLAPV
LLSKKSPIASQVEYFLVRYVFPDFTSNQGFLRARACDTIEKFEQLDFQDQNNLLTIYRHILDCMADPALPVQVTA
ALALQPLIRHDVIRTSMQQSIPTIMQQMLKLANQVDVDALANVMEDFVEVFATELTPFAVALSEQLRDTYLRIVR
ELLEKESRVDENGEVYSADYDDKSITALGVLQTIGTLILTLESTPDVLLHIEAVLMPLIEITLENKLYDLYNEVF
EIIDSCTFAAKAISPNMWRAFEMIHATFKSGAEYYLEDMLPALDNFVQYGVAQLVQKPEYVQALYSMVTDMFVDE
AHGAAERICACKLAEAMMLSLRGNIDNCVQGFIVLAMEILSQQEIKVKSFKVHLMEMVINAIHYNPLLALQLLES
KAWTNRFFSLWFGSMTSFNRVHDKKLCIVAISALLSVNAEQVPASVSVGWPRLLHGITELFRTLPEAIKNREEAL
RDDFHLETLDYGDEDEWDEEDANWNGEEETAQEDKAQIQDESKAYLEFLNDEAQKFSRSTDGDEDGDLGEDSVLL
ESPLDKIEPYQLFKATLMRLQQEQPQYYANLATHLSAEDQSMLQGIMMKADELAVQQAQLLAQQQQQGQGQRPGP
GQAPAGNAPIS*
Coding >OphauB2|671
ATGGATACCGCCGCTATTAGGGGCCTGCTCGCCGCCAGCTTGGACACGGGAGCCGACAACCGCCGTCGTGCTGAG
ATTCAGCTTAAACAGGTTGAGGGGCACCCTGGCTTCATGGATTGTCTGTTTCAGATTGTTCAAGCCGAGCAGGAC
CCCAGCGTTCGTCTATCAACTGTTATTTACATCAAAAATCGTGTCAGCCGCTCTTGGGGAGCCTCGGAATCTTCT
AGCGAGACGTTGATACCGGAAGACGAAAAGGCTCGCGTCCGAGAAATGTTGGTGCCACTTTTGGCCTCGTCGCAA
GGTCCTGTGCAACAGCAACTTGTCCCAGTTCTCCAGCGTATCCTGCAAGTCGACTTTCCCACGCGATGGCCACGC
TTTGTTGACTTCACCGCCGAGCTGCTCAACACCAACGATGCCAAGTCGGTCCATGCCGGCCTTCACTGCTTACTG
GCTCTCTGCCGCACCTATCGCTACAAGTCGGCCGAAAACAGCGACAGGCAGCAGTTTGAGACGATTGTCGAATCC
ACTTTTGTCCGCCTCCTGGCTGTCTGCAACGAACTTGTCAATCAGGAGAGCACCGAAGCTGGTGAGATGCTGCAT
TTAGCATTAAAGACGTACAAGCATGCCACTTGGCTTGAGCTGCCTCTCTGCTTGCGGCAGCCGCAAGCCAACATA
GCTTGGTGCACTGTATTCCTCAATACTGTGTCCAAAACCGCTCCAGCAGAAGCAATGCAGGGTGAGCCATCGGAC
CGCGAAACACACCATTGGTGGAAGTCGAAAAAATGGGCCTATTTCAACTTGAACCGCCTGTTTATAAGACACGGT
AATCCGACAAATCCTGGCAAGGGTGATGAAGCAGCCCAATTTGCCAAGGACTTTGCTCTCAATATCGCCCCTGAA
ATTCTCAAGCGCTATCTTCAGGAGATTGAGAAATGGGTGGCCAAAACATCATGGCTAAGTCGACCCTGTCTCTCG
TACACGCTCGGCTTTCTCGACGAGTCGGTCCGGCCAAAGGAAATGTGGACGCACCTCAAGCCTCATCTGACTAAC
CTTGTTTCTCACTTTGTCTTTCCAGTGCTGTGCTTGAATCAGGATGACGTTGAGGAATTCGAAGACCAACCTGTT
GAATATCTACACCGCAAACTCAATTACTTTGAGGAGGTTTCTGCACCCGACAATGCGGCCACAAACTTTCTTGTA
AATCTCACAAAAAATCGGCGCAAGGAAACTTTCGAGATTCTCAAATTTGTCAATGCCGTTGTTAACGAATACGAG
CAATCACCCGACGATAAGAAGAATCATGTTGCCAAGGAGGGTGCTTTGAGAATGATTGGCACATTGGCTCCTGTT
CTCCTGAGCAAAAAGAGCCCGATTGCTAGCCAGGTCGAGTATTTCCTTGTGAGATACGTCTTTCCCGACTTTACG
AGCAACCAAGGGTTCCTGCGCGCAAGAGCTTGTGACACGATTGAGAAGTTTGAGCAGCTTGATTTCCAGGACCAA
AACAACCTCCTCACAATATATCGCCATATCTTGGACTGCATGGCTGATCCGGCTCTCCCGGTGCAAGTCACTGCG
GCTCTGGCGTTGCAGCCGCTCATCAGGCACGACGTCATCAGGACCAGCATGCAGCAAAGCATTCCGACAATAATG
CAACAGATGCTCAAATTGGCAAATCAAGTGGATGTAGATGCGCTGGCCAATGTCATGGAAGATTTCGTCGAAGTG
TTCGCGACGGAGCTCACACCGTTTGCTGTGGCTCTTTCGGAACAGCTACGAGATACATATCTGCGCATCGTACGT
GAGCTCCTTGAAAAGGAGAGCCGAGTCGATGAAAATGGTGAAGTTTACTCTGCCGATTATGACGACAAGAGCATC
ACCGCTCTAGGCGTCTTGCAAACGATTGGGACCTTGATACTCACCTTGGAAAGCACGCCCGATGTCCTCCTTCAC
ATTGAAGCAGTGTTGATGCCTTTGATTGAGATTACTCTTGAGAATAAGCTCTACGATCTCTATAATGAAGTTTTC
GAAATCATTGACAGCTGCACCTTTGCGGCAAAGGCGATTTCGCCAAATATGTGGCGTGCCTTTGAAATGATTCAT
GCCACGTTCAAATCTGGCGCCGAATATTATTTGGAAGATATGCTGCCTGCTCTGGATAACTTTGTCCAGTACGGC
GTGGCCCAGCTGGTGCAGAAACCAGAGTATGTTCAGGCGCTCTACTCAATGGTGACGGACATGTTTGTCGACGAG
GCCCACGGTGCAGCTGAACGCATTTGCGCCTGCAAGCTGGCCGAGGCTATGATGCTGAGCCTCCGTGGCAACATT
GACAATTGCGTCCAGGGCTTCATTGTTTTGGCAATGGAAATCTTGAGCCAACAAGAGATCAAAGTCAAGAGTTTC
AAGGTCCATTTGATGGAAATGGTAATCAACGCCATTCATTATAACCCGTTGCTGGCACTGCAGCTTCTTGAGAGC
AAGGCATGGACCAACCGCTTCTTCAGCCTGTGGTTTGGAAGCATGACGTCCTTTAACCGTGTTCACGACAAGAAG
CTTTGCATTGTGGCCATCTCGGCGCTGCTCAGCGTCAATGCCGAGCAAGTACCCGCTAGCGTATCTGTTGGGTGG
CCGCGTCTTCTCCACGGCATCACTGAGCTGTTTAGGACTTTGCCCGAGGCCATCAAGAATCGGGAGGAAGCCTTG
CGAGATGACTTCCATTTGGAAACACTCGATTATGGCGATGAAGACGAATGGGACGAAGAAGATGCCAACTGGAAC
GGTGAAGAAGAAACCGCACAAGAAGATAAAGCTCAGATTCAGGACGAGAGCAAAGCTTATTTGGAGTTTCTTAAT
GATGAAGCTCAGAAGTTTAGTCGGTCGACTGACGGGGACGAGGATGGCGATTTGGGAGAGGATAGTGTTCTCCTC
GAATCACCGCTGGACAAGATTGAGCCATACCAATTGTTCAAGGCGACTCTGATGAGACTGCAACAAGAGCAGCCT
CAATATTACGCAAATCTAGCAACGCATCTGTCGGCAGAGGATCAAAGCATGCTGCAGGGCATCATGATGAAGGCA
GACGAATTGGCAGTACAACAAGCACAACTGTTGGCGCAGCAGCAGCAGCAAGGGCAAGGGCAAAGGCCGGGGCCC
GGACAGGCTCCGGCTGGCAACGCACCAATAAGTTAG
Transcript >OphauB2|671
ATGGATACCGCCGCTATTAGGGGCCTGCTCGCCGCCAGCTTGGACACGGGAGCCGACAACCGCCGTCGTGCTGAG
ATTCAGCTTAAACAGGTTGAGGGGCACCCTGGCTTCATGGATTGTCTGTTTCAGATTGTTCAAGCCGAGCAGGAC
CCCAGCGTTCGTCTATCAACTGTTATTTACATCAAAAATCGTGTCAGCCGCTCTTGGGGAGCCTCGGAATCTTCT
AGCGAGACGTTGATACCGGAAGACGAAAAGGCTCGCGTCCGAGAAATGTTGGTGCCACTTTTGGCCTCGTCGCAA
GGTCCTGTGCAACAGCAACTTGTCCCAGTTCTCCAGCGTATCCTGCAAGTCGACTTTCCCACGCGATGGCCACGC
TTTGTTGACTTCACCGCCGAGCTGCTCAACACCAACGATGCCAAGTCGGTCCATGCCGGCCTTCACTGCTTACTG
GCTCTCTGCCGCACCTATCGCTACAAGTCGGCCGAAAACAGCGACAGGCAGCAGTTTGAGACGATTGTCGAATCC
ACTTTTGTCCGCCTCCTGGCTGTCTGCAACGAACTTGTCAATCAGGAGAGCACCGAAGCTGGTGAGATGCTGCAT
TTAGCATTAAAGACGTACAAGCATGCCACTTGGCTTGAGCTGCCTCTCTGCTTGCGGCAGCCGCAAGCCAACATA
GCTTGGTGCACTGTATTCCTCAATACTGTGTCCAAAACCGCTCCAGCAGAAGCAATGCAGGGTGAGCCATCGGAC
CGCGAAACACACCATTGGTGGAAGTCGAAAAAATGGGCCTATTTCAACTTGAACCGCCTGTTTATAAGACACGGT
AATCCGACAAATCCTGGCAAGGGTGATGAAGCAGCCCAATTTGCCAAGGACTTTGCTCTCAATATCGCCCCTGAA
ATTCTCAAGCGCTATCTTCAGGAGATTGAGAAATGGGTGGCCAAAACATCATGGCTAAGTCGACCCTGTCTCTCG
TACACGCTCGGCTTTCTCGACGAGTCGGTCCGGCCAAAGGAAATGTGGACGCACCTCAAGCCTCATCTGACTAAC
CTTGTTTCTCACTTTGTCTTTCCAGTGCTGTGCTTGAATCAGGATGACGTTGAGGAATTCGAAGACCAACCTGTT
GAATATCTACACCGCAAACTCAATTACTTTGAGGAGGTTTCTGCACCCGACAATGCGGCCACAAACTTTCTTGTA
AATCTCACAAAAAATCGGCGCAAGGAAACTTTCGAGATTCTCAAATTTGTCAATGCCGTTGTTAACGAATACGAG
CAATCACCCGACGATAAGAAGAATCATGTTGCCAAGGAGGGTGCTTTGAGAATGATTGGCACATTGGCTCCTGTT
CTCCTGAGCAAAAAGAGCCCGATTGCTAGCCAGGTCGAGTATTTCCTTGTGAGATACGTCTTTCCCGACTTTACG
AGCAACCAAGGGTTCCTGCGCGCAAGAGCTTGTGACACGATTGAGAAGTTTGAGCAGCTTGATTTCCAGGACCAA
AACAACCTCCTCACAATATATCGCCATATCTTGGACTGCATGGCTGATCCGGCTCTCCCGGTGCAAGTCACTGCG
GCTCTGGCGTTGCAGCCGCTCATCAGGCACGACGTCATCAGGACCAGCATGCAGCAAAGCATTCCGACAATAATG
CAACAGATGCTCAAATTGGCAAATCAAGTGGATGTAGATGCGCTGGCCAATGTCATGGAAGATTTCGTCGAAGTG
TTCGCGACGGAGCTCACACCGTTTGCTGTGGCTCTTTCGGAACAGCTACGAGATACATATCTGCGCATCGTACGT
GAGCTCCTTGAAAAGGAGAGCCGAGTCGATGAAAATGGTGAAGTTTACTCTGCCGATTATGACGACAAGAGCATC
ACCGCTCTAGGCGTCTTGCAAACGATTGGGACCTTGATACTCACCTTGGAAAGCACGCCCGATGTCCTCCTTCAC
ATTGAAGCAGTGTTGATGCCTTTGATTGAGATTACTCTTGAGAATAAGCTCTACGATCTCTATAATGAAGTTTTC
GAAATCATTGACAGCTGCACCTTTGCGGCAAAGGCGATTTCGCCAAATATGTGGCGTGCCTTTGAAATGATTCAT
GCCACGTTCAAATCTGGCGCCGAATATTATTTGGAAGATATGCTGCCTGCTCTGGATAACTTTGTCCAGTACGGC
GTGGCCCAGCTGGTGCAGAAACCAGAGTATGTTCAGGCGCTCTACTCAATGGTGACGGACATGTTTGTCGACGAG
GCCCACGGTGCAGCTGAACGCATTTGCGCCTGCAAGCTGGCCGAGGCTATGATGCTGAGCCTCCGTGGCAACATT
GACAATTGCGTCCAGGGCTTCATTGTTTTGGCAATGGAAATCTTGAGCCAACAAGAGATCAAAGTCAAGAGTTTC
AAGGTCCATTTGATGGAAATGGTAATCAACGCCATTCATTATAACCCGTTGCTGGCACTGCAGCTTCTTGAGAGC
AAGGCATGGACCAACCGCTTCTTCAGCCTGTGGTTTGGAAGCATGACGTCCTTTAACCGTGTTCACGACAAGAAG
CTTTGCATTGTGGCCATCTCGGCGCTGCTCAGCGTCAATGCCGAGCAAGTACCCGCTAGCGTATCTGTTGGGTGG
CCGCGTCTTCTCCACGGCATCACTGAGCTGTTTAGGACTTTGCCCGAGGCCATCAAGAATCGGGAGGAAGCCTTG
CGAGATGACTTCCATTTGGAAACACTCGATTATGGCGATGAAGACGAATGGGACGAAGAAGATGCCAACTGGAAC
GGTGAAGAAGAAACCGCACAAGAAGATAAAGCTCAGATTCAGGACGAGAGCAAAGCTTATTTGGAGTTTCTTAAT
GATGAAGCTCAGAAGTTTAGTCGGTCGACTGACGGGGACGAGGATGGCGATTTGGGAGAGGATAGTGTTCTCCTC
GAATCACCGCTGGACAAGATTGAGCCATACCAATTGTTCAAGGCGACTCTGATGAGACTGCAACAAGAGCAGCCT
CAATATTACGCAAATCTAGCAACGCATCTGTCGGCAGAGGATCAAAGCATGCTGCAGGGCATCATGATGAAGGCA
GACGAATTGGCAGTACAACAAGCACAACTGTTGGCGCAGCAGCAGCAGCAAGGGCAAGGGCAAAGGCCGGGGCCC
GGACAGGCTCCGGCTGGCAACGCACCAATAAGTTAG
Gene >OphauB2|671
ATGGATACCGCCGCTATTAGGGGCCTGCTCGCCGCCAGCTTGGACACGGGAGCCGACAACCGCCGTCGTGCTGAG
ATTCAGCTTAAACAGGTATGTGGCACGTCTACACTAGCCATGCATTGGTCCCTTGGTCTTGGCATTTGAGTCTTT
GCTTTCGCCTCGACTCTCCCTCCATGACACGCTTGTCCCTGATGCATTTTTGATTTGCCCTCTTCAATCAAATTC
GTCAATGCTGACAAGATCTCTCTTTTTTTTTTTCACCAATTTCCTAGGTTGAGGGGCACCCTGGCTTCATGGATT
GTCTGTTTCAGATTGTTCAAGCCGAGCAGGACCCCAGCGTTCGTCTATCAAGTAAGAAGGCCACGACTTTTTGCC
ACAAAAAAAACGCGCGCCATCAACCTTGAGGTTAATACTAACCATGATTCAGCTGTTATTTACATCAAAAATCGT
GTCAGCCGCTCTTGGGGAGCCTCGGAATCTTCTAGCGAGACGTTGATACCGGAAGACGAAAAGGCTCGCGTCCGA
GAAATGTTGGTGCCACTTTTGGCCTCGTCGCAAGGTCCTGTGCAACAGCAACTTGTCCCAGTTCTCCAGCGTATC
CTGCAAGTCGACTTTCCCACGCGATGGCCACGCTTTGTTGACTTCACCGCCGAGCTGCTCAACACCAACGATGCC
AAGTCGGTCCATGCCGGCCTTCACTGCTTACTGGCTCTCTGCCGCACCTATCGCTACAAGTCGGCCGAAAACAGC
GACAGGCAGCAGTTTGAGACGATTGTCGAATCCACTTTTGTCCGCCTCCTGGCTGTCTGCAACGAACTTGTCAAT
CAGGAGAGCACCGAAGCTGGTGAGATGCTGCATTTAGCATTAAAGACGTACAAGCATGCCACTTGGGTAAAGCAA
CCTTCACTCGCACTTTTGTTTTCCCTCGAGTTGCTGCTGACACGGCTCCTAGCTTGAGCTGCCTCTCTGCTTGCG
GCAGCCGCAAGCCAACATAGCTTGGTGCACTGTATTCCTCAATACTGTGTCCAAAACCGCTCCAGCAGAAGCAAT
GCAGGGTGAGCCATCGGACCGCGAAACACACCATTGGTGGAAGTCGAAAAAATGGGCCTATTTCAACTTGAACCG
CCTGTTTATAAGGTATACTCGCTGTGAAGAAGCCTGCCAATGGACTAGATTGGTTGACCCCAACACTGCAGACAC
GGTAATCCGACAAATCCTGGCAAGGGTGATGAAGCAGCCCAATTTGCCAAGGACTTTGCTCTCAATATCGCCCCT
GAAATTCTCAAGCGCTATCTTCAGGAGATTGAGAAATGGGTGGCCAAAACATCATGGCTAAGTCGACCCTGTCTC
TCGTACACGCTCGGCTTTCTCGACGAGTCGGTCCGGCCAAAGGAAATGTGGACGCACCTCAAGCCTCATCTGACT
AACCTTGTTTCTCACTTTGTCTTTCCAGTGCTGTGCTTGAATCAGGATGACGTTGAGGAATTCGAAGACCAACCT
GTTGAATATCTACACCGCAAACTCAATTACTTTGAGGAGGTTTCTGCACCCGACAATGCGGCCACAAACTTTCTT
GTAAATCTCACAAAAAATCGGCGCAAGGAAACTTTCGAGATTCTCAAATTTGTCAATGCCGTTGTTAACGAATAC
GAGCAATCACCCGACGATAAGAAGAATCATGTTGCCAAGGAGGGTGCTTTGAGAATGATTGGCACATTGGCTCCT
GTTCTCCTGAGCAAAAAGAGCCCGATTGCTAGCCAGGTCGAGTATTTCCTTGTGAGATACGTCTTTCCCGACTTT
ACGAGCAACCAAGGGTTCCTGCGCGCAAGAGCTTGTGACACGATTGAGAAGTTTGAGCAGCTTGATTTCCAGGAC
CAAAACAACCTCCTCACAATATATCGCCATATCTTGGACTGCATGGCTGATCCGGCTCTCCCGGTGCAAGTCACT
GCGGCTCTGGCGTTGCAGCCGCTCATCAGGCACGACGTCATCAGGACCAGCATGCAGCAAAGCATTCCGACAATA
ATGCAACAGATGCTCAAATTGGCAAATCAAGTGGATGTAGATGCGCTGGCCAATGTCATGGAAGATTTCGTCGAA
GTGTTCGCGACGGAGCTCACACCGTTTGCTGTGGCTCTTTCGGAACAGCTACGAGATACATATCTGCGCATCGTA
CGTGAGCTCCTTGAAAAGGAGAGCCGAGTCGATGAAAATGGTGAAGTTTACTCTGCCGATTATGACGACAAGAGC
ATCACCGCTCTAGGCGTCTTGCAAACGATTGGGACCTTGATACTCACCTTGGAAAGCACGCCCGATGTCCTCCTT
CACATTGAAGCAGTGTTGATGCCTTTGATTGAGATTACTCTTGAGAATAAGCTCTACGGTGAGCAACTTGAAGAA
GGTAGCTCAAGAATAACTTGTTTGTGACTGATTGTTGGGGCAGATCTCTATAATGAAGTTTTCGAAATCATTGAC
AGCTGCACCTTTGCGGCAAAGGCGATTTCGCCAAATATGTGGCGTGCCTTTGAAATGATTCATGCCACGTTCAAA
TCTGGCGCCGAATATTATTTGGAAGATATGCTGCCTGCTCTGGATAACTTTGTCCAGTACGGCGTGGCCCAGCTG
GTGCAGAAACCAGAGTATGTTCAGGCGCTCTACTCAATGGTGACGGACATGTTTGTCGACGAGGCCCACGGTGCA
GCTGAACGCATTTGCGCCTGCAAGCTGGCCGAGGCTATGATGCTGAGCCTCCGTGGCAACATTGACAATTGCGTC
CAGGGCTTCATTGTTTTGGCAATGGAAATCTTGAGCCAACAAGAGATCAAAGTCAAGAGTTTCAAGGTCCATTTG
ATGGAAATGGTAATCAACGCCATTCATTATAACCCGTTGCTGGCACTGCAGCTTCTTGAGAGCAAGGCATGGACC
AACCGCTTCTTCAGCCTGTGGTTTGGAAGCATGACGTCCTTTAACCGTGTTCACGACAAGAAGCTTTGCATTGTG
GCCATCTCGGCGCTGCTCAGCGTCAATGCCGAGCAAGTACCCGCTAGCGTATCTGTTGGGTGGCCGCGTCTTCTC
CACGGCATCACTGAGCTGTTTAGGACTTTGCCCGAGGCCATCAAGAGTAAGAGTCTAGATGAATGCTGGCTACAT
GATGCAAGATTGCTGACTAGTTGGCACAATAGATCGGGAGGAAGCCTTGCGAGATGACTTCCATTTGGAAACACT
CGATTATGGCGATGAAGACGAATGGGACGAAGAAGATGCCAACTGGAACGGTGAAGAAGAAACCGCACAAGAAGA
TAAAGCTCAGATTCAGGACGAGAGCAAAGCTTATTTGGAGTTTCTTAATGATGAAGTGAGATTCAAGAAGTGTAT
GCGAACAAAGTGTACTGTACGAGTGCTGATGATGAATGGCGGTACCAGGCTCAGAAGTTTAGTCGGTCGACTGAC
GGGGACGAGGATGGCGATTTGGGAGAGGATAGTGTTCTCCTCGAATCACCGCTGGACAAGATTGAGCCATACCAA
TTGTTCAAGGCGACTCTGATGAGTGAGTGGGGTGCGCCATCAAGTACAAACAAACAGGTCGCTAATGGCTCTAAT
TTACAGGACTGCAACAAGAGCAGCCTCAATATTACGCAAATCTAGCAACGCATCTGTCGGCAGAGGATCAAAGCA
TGCTGCAGGGCATCATGATGAAGGCAGACGAATTGGCAGTACAACAAGCACAACTGTTGGCGCAGCAGCAGCAGC
AAGGGCAAGGGCAAAGGCCGGGGCCCGGACAGGCTCCGGCTGGCAACGCACCAATAAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail