© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauB2|6708 |
| Gene name | |
| Location | Contig_63:97852..99246 |
| Strand | + |
| Gene length (bp) | 1394 |
| Transcript length (bp) | 1212 |
| Coding sequence length (bp) | 1212 |
| Protein length (aa) | 404 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF06968 | BATS | Biotin and Thiamin Synthesis associated domain | 2.7E-23 | 298 | 388 |
| PF04055 | Radical_SAM | Radical SAM superfamily | 8.8E-14 | 124 | 281 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O59778|BIOB_SCHPO | Biotin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bio2 PE=1 SV=1 | 68 | 403 | 1.0E-148 |
| sp|P32451|BIOB_YEAST | Biotin synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO2 PE=1 SV=2 | 68 | 397 | 6.0E-146 |
| sp|P54967|BIOB_ARATH | Biotin synthase OS=Arabidopsis thaliana GN=BIO2 PE=2 SV=1 | 65 | 398 | 2.0E-143 |
| sp|Q11S94|BIOB_CYTH3 | Biotin synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=bioB PE=3 SV=1 | 76 | 399 | 3.0E-126 |
| sp|Q2NB65|BIOB_ERYLH | Biotin synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=bioB PE=3 SV=1 | 78 | 395 | 7.0E-125 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O59778|BIOB_SCHPO | Biotin synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bio2 PE=1 SV=1 | 68 | 403 | 1.0E-148 |
| sp|P32451|BIOB_YEAST | Biotin synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO2 PE=1 SV=2 | 68 | 397 | 6.0E-146 |
| sp|P54967|BIOB_ARATH | Biotin synthase OS=Arabidopsis thaliana GN=BIO2 PE=2 SV=1 | 65 | 398 | 2.0E-143 |
| sp|Q11S94|BIOB_CYTH3 | Biotin synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=bioB PE=3 SV=1 | 76 | 399 | 3.0E-126 |
| sp|Q2NB65|BIOB_ERYLH | Biotin synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=bioB PE=3 SV=1 | 78 | 395 | 7.0E-125 |
| sp|B0VCA8|BIOB_ACIBY | Biotin synthase OS=Acinetobacter baumannii (strain AYE) GN=bioB PE=3 SV=2 | 78 | 392 | 4.0E-122 |
| sp|A3M4U4|BIOB_ACIBT | Biotin synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=bioB PE=3 SV=2 | 78 | 392 | 4.0E-122 |
| sp|B2HYX9|BIOB_ACIBC | Biotin synthase OS=Acinetobacter baumannii (strain ACICU) GN=bioB PE=3 SV=1 | 78 | 392 | 4.0E-122 |
| sp|B7I4I4|BIOB_ACIB5 | Biotin synthase OS=Acinetobacter baumannii (strain AB0057) GN=bioB PE=3 SV=1 | 78 | 392 | 4.0E-122 |
| sp|B7H3S4|BIOB_ACIB3 | Biotin synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=bioB PE=3 SV=1 | 78 | 392 | 4.0E-122 |
| sp|B0VR41|BIOB_ACIBS | Biotin synthase OS=Acinetobacter baumannii (strain SDF) GN=bioB PE=3 SV=2 | 78 | 390 | 2.0E-121 |
| sp|Q6FAP9|BIOB_ACIAD | Biotin synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=bioB PE=3 SV=2 | 78 | 390 | 3.0E-120 |
| sp|Q93GG2|BIOB_ACICA | Biotin synthase OS=Acinetobacter calcoaceticus GN=bioB PE=3 SV=1 | 78 | 393 | 1.0E-119 |
| sp|Q8PDF0|BIOB_XANCP | Biotin synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=bioB PE=3 SV=1 | 78 | 392 | 1.0E-118 |
| sp|B0RMR2|BIOB_XANCB | Biotin synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=bioB PE=3 SV=1 | 78 | 392 | 1.0E-118 |
| sp|Q4UZN8|BIOB_XANC8 | Biotin synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=bioB PE=3 SV=1 | 78 | 392 | 1.0E-118 |
| sp|Q7MLV0|BIOB_VIBVY | Biotin synthase OS=Vibrio vulnificus (strain YJ016) GN=bioB PE=3 SV=2 | 76 | 398 | 2.0E-118 |
| sp|Q8D8M9|BIOB_VIBVU | Biotin synthase OS=Vibrio vulnificus (strain CMCP6) GN=bioB PE=3 SV=2 | 76 | 398 | 2.0E-118 |
| sp|P36569|BIOB_SERMA | Biotin synthase OS=Serratia marcescens GN=bioB PE=3 SV=2 | 78 | 403 | 2.0E-117 |
| sp|B5EUQ0|BIOB_VIBFM | Biotin synthase OS=Vibrio fischeri (strain MJ11) GN=bioB PE=3 SV=1 | 76 | 401 | 8.0E-117 |
| sp|A7HP26|BIOB_PARL1 | Biotin synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=bioB PE=3 SV=2 | 78 | 391 | 9.0E-117 |
| sp|B1WN69|BIOB_VIBF1 | Biotin synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=bioB PE=3 SV=1 | 76 | 401 | 9.0E-117 |
| sp|Q609V2|BIOB_METCA | Biotin synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=bioB PE=3 SV=2 | 74 | 388 | 2.0E-116 |
| sp|A7MX36|BIOB_VIBCB | Biotin synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=bioB PE=3 SV=2 | 76 | 398 | 2.0E-116 |
| sp|Q2NUJ7|BIOB_SODGM | Biotin synthase OS=Sodalis glossinidius (strain morsitans) GN=bioB PE=3 SV=1 | 79 | 392 | 3.0E-116 |
| sp|Q87QN6|BIOB_VIBPA | Biotin synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=bioB PE=3 SV=1 | 76 | 398 | 5.0E-116 |
| sp|B2J914|BIOB_NOSP7 | Biotin synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=bioB PE=3 SV=1 | 78 | 388 | 8.0E-116 |
| sp|Q9KSZ4|BIOB_VIBCH | Biotin synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=bioB PE=3 SV=1 | 76 | 389 | 2.0E-115 |
| sp|A5F2H3|BIOB_VIBC3 | Biotin synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=bioB PE=3 SV=1 | 76 | 389 | 2.0E-115 |
| sp|Q3J9D5|BIOB_NITOC | Biotin synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=bioB PE=3 SV=1 | 77 | 388 | 2.0E-115 |
| sp|B0T1Y4|BIOB_CAUSK | Biotin synthase OS=Caulobacter sp. (strain K31) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-115 |
| sp|A9MJE6|BIOB_SALAR | Biotin synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-115 |
| sp|Q2GAF7|BIOB_NOVAD | Biotin synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=bioB PE=3 SV=1 | 78 | 395 | 2.0E-115 |
| sp|Q1GTT5|BIOB_SPHAL | Biotin synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=bioB PE=3 SV=1 | 78 | 395 | 3.0E-115 |
| sp|B6ESC7|BIOB_ALISL | Biotin synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=bioB PE=3 SV=1 | 76 | 401 | 3.0E-115 |
| sp|P12678|BIOB_SALTY | Biotin synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioB PE=3 SV=2 | 74 | 393 | 8.0E-115 |
| sp|C0PWY2|BIOB_SALPC | Biotin synthase OS=Salmonella paratyphi C (strain RKS4594) GN=bioB PE=3 SV=1 | 74 | 393 | 8.0E-115 |
| sp|A9MTI8|BIOB_SALPB | Biotin synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=bioB PE=3 SV=1 | 74 | 393 | 8.0E-115 |
| sp|B4SZJ7|BIOB_SALNS | Biotin synthase OS=Salmonella newport (strain SL254) GN=bioB PE=3 SV=1 | 74 | 393 | 8.0E-115 |
| sp|Q47862|BIOB_ESCVU | Biotin synthase OS=Escherichia vulneris GN=bioB PE=3 SV=1 | 81 | 393 | 1.0E-114 |
| sp|Q1DCV9|BIOB_MYXXD | Biotin synthase OS=Myxococcus xanthus (strain DK 1622) GN=bioB PE=3 SV=1 | 58 | 388 | 1.0E-114 |
| sp|B5R761|BIOB_SALG2 | Biotin synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=bioB PE=3 SV=1 | 74 | 393 | 1.0E-114 |
| sp|Q57RG3|BIOB_SALCH | Biotin synthase OS=Salmonella choleraesuis (strain SC-B67) GN=bioB PE=3 SV=1 | 74 | 393 | 1.0E-114 |
| sp|B4ESU3|BIOB_PROMH | Biotin synthase OS=Proteus mirabilis (strain HI4320) GN=bioB PE=3 SV=1 | 81 | 392 | 2.0E-114 |
| sp|B4TQT9|BIOB_SALSV | Biotin synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|B5BC31|BIOB_SALPK | Biotin synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|Q5PG48|BIOB_SALPA | Biotin synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|B4TC48|BIOB_SALHS | Biotin synthase OS=Salmonella heidelberg (strain SL476) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|B5QX65|BIOB_SALEP | Biotin synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|B5FP61|BIOB_SALDC | Biotin synthase OS=Salmonella dublin (strain CT_02021853) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|Q8Z893|BIOB_SALTI | Biotin synthase OS=Salmonella typhi GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|B5F072|BIOB_SALA4 | Biotin synthase OS=Salmonella agona (strain SL483) GN=bioB PE=3 SV=1 | 74 | 393 | 2.0E-114 |
| sp|A4SPR7|BIOB_AERS4 | Biotin synthase OS=Aeromonas salmonicida (strain A449) GN=bioB PE=3 SV=1 | 78 | 401 | 2.0E-114 |
| sp|B7VH16|BIOB_VIBTL | Biotin synthase OS=Vibrio tasmaniensis (strain LGP32) GN=bioB PE=3 SV=1 | 76 | 401 | 4.0E-114 |
| sp|A1JS69|BIOB_YERE8 | Biotin synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=bioB PE=3 SV=1 | 81 | 396 | 4.0E-114 |
| sp|Q21FY3|BIOB_SACD2 | Biotin synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=bioB PE=3 SV=1 | 78 | 389 | 5.0E-114 |
| sp|A9EXH2|BIOB_SORC5 | Biotin synthase OS=Sorangium cellulosum (strain So ce56) GN=bioB PE=3 SV=2 | 71 | 391 | 6.0E-114 |
| sp|A6X2S8|BIOB_OCHA4 | Biotin synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=bioB PE=3 SV=1 | 70 | 390 | 9.0E-114 |
| sp|A8AJ12|BIOB_CITK8 | Biotin synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=bioB PE=3 SV=1 | 74 | 393 | 1.0E-113 |
| sp|A0M7A9|BIOB_GRAFK | Biotin synthase OS=Gramella forsetii (strain KT0803) GN=bioB PE=3 SV=1 | 78 | 397 | 1.0E-113 |
| sp|B5YRL4|BIOB_ECO5E | Biotin synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=bioB PE=3 SV=1 | 74 | 393 | 1.0E-113 |
| sp|Q8X825|BIOB_ECO57 | Biotin synthase OS=Escherichia coli O157:H7 GN=bioB PE=3 SV=3 | 74 | 393 | 1.0E-113 |
| sp|Q138Z3|BIOB_RHOPS | Biotin synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=bioB PE=3 SV=1 | 68 | 389 | 2.0E-113 |
| sp|A6T6L5|BIOB_KLEP7 | Biotin synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=bioB PE=3 SV=2 | 74 | 393 | 2.0E-113 |
| sp|A5FLT1|BIOB_FLAJ1 | Biotin synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=bioB PE=3 SV=1 | 78 | 394 | 2.0E-113 |
| sp|B7LJY8|BIOB_ESCF3 | Biotin synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-113 |
| sp|Q7N6Q7|BIOB_PHOLL | Biotin synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=bioB PE=3 SV=1 | 78 | 393 | 3.0E-113 |
| sp|B1JSS4|BIOB_YERPY | Biotin synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|Q66D67|BIOB_YERPS | Biotin synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|A4TNQ6|BIOB_YERPP | Biotin synthase OS=Yersinia pestis (strain Pestoides F) GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|Q1CFQ3|BIOB_YERPN | Biotin synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|A9R3C8|BIOB_YERPG | Biotin synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|Q7CH65|BIOB_YERPE | Biotin synthase OS=Yersinia pestis GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|B2K8T0|BIOB_YERPB | Biotin synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|Q1C947|BIOB_YERPA | Biotin synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=bioB PE=3 SV=1 | 81 | 393 | 3.0E-113 |
| sp|A8GBC5|BIOB_SERP5 | Biotin synthase OS=Serratia proteamaculans (strain 568) GN=bioB PE=3 SV=1 | 78 | 399 | 4.0E-113 |
| sp|Q9A2N5|BIOB_CAUCR | Biotin synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=bioB PE=3 SV=1 | 77 | 391 | 4.0E-113 |
| sp|B8H640|BIOB_CAUCN | Biotin synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=bioB PE=3 SV=1 | 77 | 391 | 4.0E-113 |
| sp|A7FKM9|BIOB_YERP3 | Biotin synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=bioB PE=3 SV=1 | 81 | 393 | 4.0E-113 |
| sp|A1SW31|BIOB_PSYIN | Biotin synthase OS=Psychromonas ingrahamii (strain 37) GN=bioB PE=3 SV=1 | 76 | 389 | 4.0E-113 |
| sp|Q0TJS3|BIOB_ECOL5 | Biotin synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=bioB PE=3 SV=1 | 74 | 393 | 5.0E-113 |
| sp|Q0VMD0|BIOB_ALCBS | Biotin synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=bioB PE=3 SV=1 | 78 | 391 | 7.0E-113 |
| sp|Q1I3N6|BIOB_PSEE4 | Biotin synthase OS=Pseudomonas entomophila (strain L48) GN=bioB PE=3 SV=1 | 78 | 388 | 7.0E-113 |
| sp|Q3Z409|BIOB_SHISS | Biotin synthase OS=Shigella sonnei (strain Ss046) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|B1LM66|BIOB_ECOSM | Biotin synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|B7NA74|BIOB_ECOLU | Biotin synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|P12996|BIOB_ECOLI | Biotin synthase OS=Escherichia coli (strain K12) GN=bioB PE=1 SV=2 | 74 | 393 | 7.0E-113 |
| sp|B1IXJ3|BIOB_ECOLC | Biotin synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|A7ZY31|BIOB_ECOHS | Biotin synthase OS=Escherichia coli O9:H4 (strain HS) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|B1X7A5|BIOB_ECODH | Biotin synthase OS=Escherichia coli (strain K12 / DH10B) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|B7M747|BIOB_ECO8A | Biotin synthase OS=Escherichia coli O8 (strain IAI1) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|B7NNK5|BIOB_ECO7I | Biotin synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|B7LC57|BIOB_ECO55 | Biotin synthase OS=Escherichia coli (strain 55989 / EAEC) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|B7ULX2|BIOB_ECO27 | Biotin synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|A7ZJI4|BIOB_ECO24 | Biotin synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=bioB PE=3 SV=1 | 74 | 393 | 7.0E-113 |
| sp|Q83S46|BIOB_SHIFL | Biotin synthase OS=Shigella flexneri GN=bioB PE=3 SV=1 | 74 | 393 | 8.0E-113 |
| sp|Q0T6I5|BIOB_SHIF8 | Biotin synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=bioB PE=3 SV=1 | 74 | 393 | 8.0E-113 |
| sp|Q5QZ16|BIOB_IDILO | Biotin synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=bioB PE=3 SV=1 | 78 | 399 | 1.0E-112 |
| sp|A5CWW0|BIOB_VESOH | Biotin synthase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=bioB PE=3 SV=1 | 78 | 389 | 2.0E-112 |
| sp|A4W8B7|BIOB_ENT38 | Biotin synthase OS=Enterobacter sp. (strain 638) GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-112 |
| sp|Q88QX2|BIOB_PSEPK | Biotin synthase OS=Pseudomonas putida (strain KT2440) GN=bioB PE=3 SV=1 | 78 | 388 | 3.0E-112 |
| sp|B6I7S9|BIOB_ECOSE | Biotin synthase OS=Escherichia coli (strain SE11) GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-112 |
| sp|A4XZR9|BIOB_PSEMY | Biotin synthase OS=Pseudomonas mendocina (strain ymp) GN=bioB PE=3 SV=1 | 71 | 398 | 3.0E-112 |
| sp|A5VAC6|BIOB_SPHWW | Biotin synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=bioB PE=3 SV=1 | 78 | 391 | 3.0E-112 |
| sp|B2IEZ6|BIOB_BEII9 | Biotin synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=bioB PE=3 SV=1 | 78 | 383 | 3.0E-112 |
| sp|A5VXF1|BIOB_PSEP1 | Biotin synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=bioB PE=3 SV=1 | 78 | 388 | 3.0E-112 |
| sp|Q1REF5|BIOB_ECOUT | Biotin synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-112 |
| sp|Q8FJQ3|BIOB_ECOL6 | Biotin synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-112 |
| sp|A1A917|BIOB_ECOK1 | Biotin synthase OS=Escherichia coli O1:K1 / APEC GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-112 |
| sp|B7MQM8|BIOB_ECO81 | Biotin synthase OS=Escherichia coli O81 (strain ED1a) GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-112 |
| sp|B7MGN3|BIOB_ECO45 | Biotin synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=bioB PE=3 SV=1 | 74 | 393 | 3.0E-112 |
| sp|Q6LPR2|BIOB_PHOPR | Biotin synthase OS=Photobacterium profundum GN=bioB PE=3 SV=1 | 76 | 401 | 4.0E-112 |
| sp|A1AWE7|BIOB_RUTMC | Biotin synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=bioB PE=3 SV=1 | 75 | 389 | 4.0E-112 |
| sp|A1U4B2|BIOB_MARHV | Biotin synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=bioB PE=3 SV=1 | 78 | 388 | 4.0E-112 |
| sp|Q5FPC9|BIOB_GLUOX | Biotin synthase OS=Gluconobacter oxydans (strain 621H) GN=bioB PE=3 SV=2 | 78 | 399 | 4.0E-112 |
| sp|Q32I44|BIOB_SHIDS | Biotin synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=bioB PE=3 SV=1 | 74 | 393 | 4.0E-112 |
| sp|A0KIC6|BIOB_AERHH | Biotin synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=bioB PE=3 SV=1 | 78 | 401 | 7.0E-112 |
| sp|Q3M4U9|BIOB_ANAVT | Biotin synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-111 |
| sp|A7MJ03|BIOB_CROS8 | Biotin synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=bioB PE=3 SV=1 | 81 | 393 | 1.0E-111 |
| sp|Q324B7|BIOB_SHIBS | Biotin synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=bioB PE=3 SV=1 | 74 | 393 | 1.0E-111 |
| sp|B2TVF5|BIOB_SHIB3 | Biotin synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=bioB PE=3 SV=1 | 74 | 393 | 1.0E-111 |
| sp|B2VBT9|BIOB_ERWT9 | Biotin synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=bioB PE=3 SV=1 | 81 | 389 | 1.0E-111 |
| sp|B0KJ53|BIOB_PSEPG | Biotin synthase OS=Pseudomonas putida (strain GB-1) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-111 |
| sp|Q8YVQ3|BIOB_NOSS1 | Biotin synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-111 |
| sp|A4VR88|BIOB_PSEU5 | Biotin synthase OS=Pseudomonas stutzeri (strain A1501) GN=bioB PE=3 SV=1 | 71 | 398 | 2.0E-111 |
| sp|Q15SR5|BIOB_PSEA6 | Biotin synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=bioB PE=3 SV=1 | 74 | 398 | 3.0E-111 |
| sp|A1S5I9|BIOB_SHEAM | Biotin synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=bioB PE=3 SV=1 | 78 | 388 | 3.0E-111 |
| sp|Q8PQD7|BIOB_XANAC | Biotin synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=bioB PE=3 SV=1 | 78 | 392 | 3.0E-111 |
| sp|A6GW77|BIOB_FLAPJ | Biotin synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=bioB PE=3 SV=1 | 78 | 394 | 4.0E-111 |
| sp|Q3IGS6|BIOB_PSEHT | Biotin synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=bioB PE=3 SV=1 | 78 | 389 | 4.0E-111 |
| sp|Q8FWG3|BIOB_BRUSU | Biotin synthase OS=Brucella suis biovar 1 (strain 1330) GN=bioB PE=3 SV=1 | 81 | 390 | 4.0E-111 |
| sp|A9WYH2|BIOB_BRUSI | Biotin synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-111 |
| sp|Q8YBW1|BIOB_BRUME | Biotin synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-111 |
| sp|C0RL26|BIOB_BRUMB | Biotin synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-111 |
| sp|A9MBD6|BIOB_BRUC2 | Biotin synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-111 |
| sp|Q577P8|BIOB_BRUAB | Biotin synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-111 |
| sp|Q2YKB8|BIOB_BRUA2 | Biotin synthase OS=Brucella abortus (strain 2308) GN=bioB PE=3 SV=1 | 81 | 390 | 4.0E-111 |
| sp|B2SBF0|BIOB_BRUA1 | Biotin synthase OS=Brucella abortus (strain S19) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-111 |
| sp|A5VUG1|BIOB_BRUO2 | Biotin synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-111 |
| sp|Q5ZVG8|BIOB_LEGPH | Biotin synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=bioB PE=3 SV=1 | 76 | 391 | 5.0E-111 |
| sp|Q5X592|BIOB_LEGPA | Biotin synthase OS=Legionella pneumophila (strain Paris) GN=bioB PE=3 SV=1 | 76 | 391 | 5.0E-111 |
| sp|Q4ZMA8|BIOB_PSEU2 | Biotin synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=bioB PE=3 SV=1 | 78 | 388 | 6.0E-111 |
| sp|Q88A98|BIOB_PSESM | Biotin synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=bioB PE=3 SV=1 | 78 | 388 | 9.0E-111 |
| sp|Q6D3B9|BIOB_PECAS | Biotin synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=bioB PE=3 SV=1 | 81 | 393 | 9.0E-111 |
| sp|B1JE55|BIOB_PSEPW | Biotin synthase OS=Pseudomonas putida (strain W619) GN=bioB PE=3 SV=1 | 78 | 388 | 9.0E-111 |
| sp|Q48CS1|BIOB_PSE14 | Biotin synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-110 |
| sp|A5IBW2|BIOB_LEGPC | Biotin synthase OS=Legionella pneumophila (strain Corby) GN=bioB PE=3 SV=1 | 76 | 391 | 1.0E-110 |
| sp|Q3BYM9|BIOB_XANC5 | Biotin synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=bioB PE=3 SV=1 | 78 | 392 | 1.0E-110 |
| sp|Q2IUT3|BIOB_RHOP2 | Biotin synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=bioB PE=3 SV=1 | 71 | 389 | 1.0E-110 |
| sp|Q4K4T2|BIOB_PSEF5 | Biotin synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=bioB PE=3 SV=2 | 78 | 388 | 2.0E-110 |
| sp|Q2W3L4|BIOB_MAGSA | Biotin synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=bioB PE=3 SV=1 | 76 | 391 | 2.0E-110 |
| sp|B5XZ75|BIOB_KLEP3 | Biotin synthase OS=Klebsiella pneumoniae (strain 342) GN=bioB PE=3 SV=1 | 78 | 393 | 2.0E-110 |
| sp|Q02TR6|BIOB_PSEAB | Biotin synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=bioB PE=3 SV=1 | 71 | 398 | 2.0E-110 |
| sp|Q5WW97|BIOB_LEGPL | Biotin synthase OS=Legionella pneumophila (strain Lens) GN=bioB PE=3 SV=1 | 76 | 391 | 3.0E-110 |
| sp|A8FX10|BIOB_SHESH | Biotin synthase OS=Shewanella sediminis (strain HAW-EB3) GN=bioB PE=3 SV=1 | 78 | 388 | 3.0E-110 |
| sp|Q0HTY9|BIOB_SHESR | Biotin synthase OS=Shewanella sp. (strain MR-7) GN=bioB PE=3 SV=1 | 78 | 388 | 4.0E-110 |
| sp|Q0HHN7|BIOB_SHESM | Biotin synthase OS=Shewanella sp. (strain MR-4) GN=bioB PE=3 SV=1 | 78 | 388 | 4.0E-110 |
| sp|A0KY79|BIOB_SHESA | Biotin synthase OS=Shewanella sp. (strain ANA-3) GN=bioB PE=3 SV=1 | 78 | 388 | 4.0E-110 |
| sp|B1KPJ7|BIOB_SHEWM | Biotin synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=bioB PE=3 SV=1 | 78 | 388 | 4.0E-110 |
| sp|B4S0P9|BIOB_ALTMD | Biotin synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=bioB PE=3 SV=1 | 78 | 403 | 5.0E-110 |
| sp|B3PI87|BIOB_CELJU | Biotin synthase OS=Cellvibrio japonicus (strain Ueda107) GN=bioB PE=3 SV=2 | 78 | 388 | 5.0E-110 |
| sp|Q0ATN3|BIOB_MARMM | Biotin synthase OS=Maricaulis maris (strain MCS10) GN=bioB PE=3 SV=1 | 67 | 392 | 5.0E-110 |
| sp|A6UYW0|BIOB_PSEA7 | Biotin synthase OS=Pseudomonas aeruginosa (strain PA7) GN=bioB PE=3 SV=1 | 71 | 398 | 6.0E-110 |
| sp|Q8EDK6|BIOB_SHEON | Biotin synthase OS=Shewanella oneidensis (strain MR-1) GN=bioB PE=3 SV=1 | 78 | 388 | 6.0E-110 |
| sp|A9CFX5|BIOB_AGRFC | Biotin synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=bioB PE=3 SV=1 | 84 | 400 | 6.0E-110 |
| sp|B3QCX3|BIOB_RHOPT | Biotin synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=bioB PE=3 SV=1 | 67 | 389 | 7.0E-110 |
| sp|Q6N859|BIOB_RHOPA | Biotin synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=bioB PE=3 SV=1 | 67 | 389 | 7.0E-110 |
| sp|Q8D2A1|BIOB_WIGBR | Biotin synthase OS=Wigglesworthia glossinidia brevipalpis GN=bioB PE=3 SV=2 | 81 | 388 | 7.0E-110 |
| sp|Q212A8|BIOB_RHOPB | Biotin synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=bioB PE=3 SV=1 | 78 | 388 | 8.0E-110 |
| sp|Q9I618|BIOB_PSEAE | Biotin synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bioB PE=3 SV=1 | 71 | 398 | 1.0E-109 |
| sp|B7V485|BIOB_PSEA8 | Biotin synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=bioB PE=3 SV=1 | 71 | 398 | 1.0E-109 |
| sp|A1RIK5|BIOB_SHESW | Biotin synthase OS=Shewanella sp. (strain W3-18-1) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-109 |
| sp|A4Y7Y3|BIOB_SHEPC | Biotin synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-109 |
| sp|A9HRF2|BIOB_GLUDA | Biotin synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=bioB PE=3 SV=2 | 78 | 388 | 2.0E-109 |
| sp|Q3K5P1|BIOB_PSEPF | Biotin synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-109 |
| sp|A6W0Y1|BIOB_MARMS | Biotin synthase OS=Marinomonas sp. (strain MWYL1) GN=bioB PE=3 SV=2 | 77 | 398 | 2.0E-109 |
| sp|Q8Y2R9|BIOB_RALSO | Biotin synthase OS=Ralstonia solanacearum (strain GMI1000) GN=bioB PE=3 SV=1 | 75 | 401 | 3.0E-109 |
| sp|B2UDA1|BIOB_RALPJ | Biotin synthase OS=Ralstonia pickettii (strain 12J) GN=bioB PE=3 SV=1 | 77 | 388 | 3.0E-109 |
| sp|Q9PH80|BIOB_XYLFA | Biotin synthase OS=Xylella fastidiosa (strain 9a5c) GN=bioB PE=3 SV=1 | 78 | 396 | 3.0E-109 |
| sp|A1VUJ4|BIOB_POLNA | Biotin synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=bioB PE=3 SV=1 | 79 | 388 | 5.0E-109 |
| sp|Q0A5W1|BIOB_ALKEH | Biotin synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=bioB PE=3 SV=2 | 77 | 388 | 6.0E-109 |
| sp|Q87F85|BIOB_XYLFT | Biotin synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=bioB PE=3 SV=1 | 78 | 396 | 9.0E-109 |
| sp|B2I672|BIOB_XYLF2 | Biotin synthase OS=Xylella fastidiosa (strain M23) GN=bioB PE=3 SV=1 | 78 | 396 | 9.0E-109 |
| sp|B0U2A0|BIOB_XYLFM | Biotin synthase OS=Xylella fastidiosa (strain M12) GN=bioB PE=3 SV=1 | 78 | 396 | 9.0E-109 |
| sp|Q07PI4|BIOB_RHOP5 | Biotin synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=bioB PE=3 SV=1 | 78 | 390 | 1.0E-108 |
| sp|Q31E55|BIOB_THICR | Biotin synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=bioB PE=3 SV=1 | 72 | 388 | 2.0E-108 |
| sp|A7IEC3|BIOB_XANP2 | Biotin synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=bioB PE=3 SV=1 | 78 | 390 | 2.0E-108 |
| sp|Q2SBD4|BIOB_HAHCH | Biotin synthase OS=Hahella chejuensis (strain KCTC 2396) GN=bioB PE=3 SV=1 | 78 | 388 | 5.0E-108 |
| sp|Q5H5R1|BIOB_XANOR | Biotin synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=bioB PE=3 SV=2 | 78 | 392 | 7.0E-108 |
| sp|B2SS67|BIOB_XANOP | Biotin synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=bioB PE=3 SV=1 | 78 | 392 | 7.0E-108 |
| sp|Q2P8F3|BIOB_XANOM | Biotin synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=bioB PE=3 SV=1 | 78 | 392 | 7.0E-108 |
| sp|Q12D73|BIOB2_POLSJ | Biotin synthase 2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioB2 PE=3 SV=2 | 81 | 388 | 9.0E-108 |
| sp|A9KY60|BIOB_SHEB9 | Biotin synthase OS=Shewanella baltica (strain OS195) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-107 |
| sp|A6WM55|BIOB_SHEB8 | Biotin synthase OS=Shewanella baltica (strain OS185) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-107 |
| sp|A3D3F2|BIOB_SHEB5 | Biotin synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-107 |
| sp|B8EAJ2|BIOB_SHEB2 | Biotin synthase OS=Shewanella baltica (strain OS223) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-107 |
| sp|B4SM81|BIOB_STRM5 | Biotin synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=bioB PE=3 SV=1 | 78 | 391 | 4.0E-107 |
| sp|Q2JRI4|BIOB_SYNJA | Biotin synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=bioB PE=3 SV=1 | 89 | 391 | 5.0E-107 |
| sp|Q3YRG6|BIOB_EHRCJ | Biotin synthase OS=Ehrlichia canis (strain Jake) GN=bioB PE=3 SV=1 | 78 | 387 | 6.0E-107 |
| sp|Q1QRH1|BIOB_NITHX | Biotin synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=bioB PE=3 SV=1 | 74 | 388 | 7.0E-107 |
| sp|B2FLM4|BIOB_STRMK | Biotin synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=bioB PE=3 SV=1 | 78 | 391 | 7.0E-107 |
| sp|A1B656|BIOB2_PARDP | Biotin synthase 2 OS=Paracoccus denitrificans (strain Pd 1222) GN=bioB2 PE=3 SV=1 | 77 | 390 | 8.0E-107 |
| sp|B8GTH4|BIOB_THISH | Biotin synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=bioB PE=3 SV=1 | 71 | 400 | 1.0E-106 |
| sp|Q5PA14|BIOB_ANAMM | Biotin synthase OS=Anaplasma marginale (strain St. Maries) GN=bioB PE=3 SV=1 | 78 | 393 | 2.0E-106 |
| sp|B9KGM2|BIOB_ANAMF | Biotin synthase OS=Anaplasma marginale (strain Florida) GN=bioB PE=3 SV=1 | 78 | 393 | 2.0E-106 |
| sp|A8H3I7|BIOB_SHEPA | Biotin synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-106 |
| sp|B8D7I5|BIOB_BUCAT | Biotin synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-106 |
| sp|Q8K9P1|BIOB_BUCAP | Biotin synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-106 |
| sp|B8D983|BIOB_BUCA5 | Biotin synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-106 |
| sp|P57378|BIOB_BUCAI | Biotin synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=bioB PE=3 SV=1 | 78 | 388 | 3.0E-106 |
| sp|Q5L5F9|BIOB_CHLAB | Biotin synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=bioB PE=3 SV=1 | 81 | 403 | 4.0E-106 |
| sp|B4RBP5|BIOB_PHEZH | Biotin synthase OS=Phenylobacterium zucineum (strain HLK1) GN=bioB PE=3 SV=1 | 72 | 391 | 5.0E-106 |
| sp|B0TJN8|BIOB_SHEHH | Biotin synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=bioB PE=3 SV=1 | 78 | 388 | 7.0E-106 |
| sp|A1K9C8|BIOB_AZOSB | Biotin synthase OS=Azoarcus sp. (strain BH72) GN=bioB PE=3 SV=1 | 78 | 388 | 7.0E-106 |
| sp|B1Y502|BIOB_LEPCP | Biotin synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=bioB PE=3 SV=1 | 85 | 388 | 9.0E-106 |
| sp|Q2KWF1|BIOB_BORA1 | Biotin synthase OS=Bordetella avium (strain 197N) GN=bioB PE=3 SV=1 | 81 | 388 | 1.0E-105 |
| sp|B8CQY2|BIOB_SHEPW | Biotin synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-105 |
| sp|B2JKH4|BIOB_BURP8 | Biotin synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=bioB PE=3 SV=1 | 81 | 390 | 2.0E-105 |
| sp|Q255G8|BIOB_CHLFF | Biotin synthase OS=Chlamydophila felis (strain Fe/C-56) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-105 |
| sp|Q5N332|BIOB_SYNP6 | Biotin synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=bioB PE=3 SV=1 | 78 | 391 | 3.0E-105 |
| sp|Q31R68|BIOB_SYNE7 | Biotin synthase OS=Synechococcus elongatus (strain PCC 7942) GN=bioB PE=3 SV=1 | 78 | 391 | 3.0E-105 |
| sp|B0U811|BIOB_METS4 | Biotin synthase OS=Methylobacterium sp. (strain 4-46) GN=bioB PE=3 SV=1 | 78 | 388 | 3.0E-105 |
| sp|B9JYY6|BIOB_AGRVS | Biotin synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=bioB PE=3 SV=1 | 73 | 387 | 7.0E-105 |
| sp|Q0C661|BIOB_HYPNA | Biotin synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=bioB PE=3 SV=1 | 77 | 383 | 8.0E-105 |
| sp|A2C3I4|BIOB_PROM1 | Biotin synthase OS=Prochlorococcus marinus (strain NATL1A) GN=bioB PE=3 SV=1 | 71 | 390 | 8.0E-105 |
| sp|Q46K32|BIOB_PROMT | Biotin synthase OS=Prochlorococcus marinus (strain NATL2A) GN=bioB PE=3 SV=1 | 71 | 390 | 9.0E-105 |
| sp|B8IU36|BIOB_METNO | Biotin synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=bioB PE=3 SV=1 | 78 | 388 | 9.0E-105 |
| sp|Q1MRA1|BIOB_LAWIP | Biotin synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=bioB PE=3 SV=2 | 78 | 393 | 1.0E-104 |
| sp|B5ELR8|BIOB_ACIF5 | Biotin synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=bioB PE=3 SV=1 | 86 | 388 | 1.0E-104 |
| sp|B7J403|BIOB_ACIF2 | Biotin synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=bioB PE=3 SV=1 | 86 | 388 | 1.0E-104 |
| sp|Q481G0|BIOB_COLP3 | Biotin synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=bioB PE=3 SV=2 | 78 | 389 | 2.0E-104 |
| sp|Q9AMS7|BIOB_BRADU | Biotin synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=bioB PE=3 SV=1 | 69 | 390 | 2.0E-104 |
| sp|Q9Z6L5|BIOB_CHLPN | Biotin synthase OS=Chlamydia pneumoniae GN=bioB PE=3 SV=1 | 75 | 400 | 2.0E-104 |
| sp|Q7NDA8|BIOB_GLOVI | Biotin synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=bioB PE=3 SV=1 | 82 | 388 | 3.0E-104 |
| sp|Q2GLB4|BIOB_ANAPZ | Biotin synthase OS=Anaplasma phagocytophilum (strain HZ) GN=bioB PE=3 SV=1 | 78 | 397 | 4.0E-104 |
| sp|A5FZN9|BIOB_ACICJ | Biotin synthase OS=Acidiphilium cryptum (strain JF-5) GN=bioB PE=3 SV=1 | 100 | 391 | 4.0E-104 |
| sp|Q2GHB1|BIOB_EHRCR | Biotin synthase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=bioB PE=3 SV=1 | 78 | 388 | 7.0E-104 |
| sp|Q5NRD6|BIOB_ZYMMO | Biotin synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=bioB PE=3 SV=2 | 78 | 390 | 1.0E-103 |
| sp|Q65SD0|BIOB_MANSM | Biotin synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=bioB PE=3 SV=1 | 81 | 388 | 1.0E-103 |
| sp|A1WVM7|BIOB_HALHL | Biotin synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=bioB PE=3 SV=1 | 81 | 389 | 1.0E-103 |
| sp|Q1GZA6|BIOB_METFK | Biotin synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=bioB PE=3 SV=1 | 65 | 391 | 2.0E-103 |
| sp|Q5P7M6|BIOB_AROAE | Biotin synthase OS=Aromatoleum aromaticum (strain EbN1) GN=bioB PE=3 SV=2 | 78 | 388 | 2.0E-103 |
| sp|A3QDN8|BIOB_SHELP | Biotin synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-103 |
| sp|A4SV63|BIOB_POLSQ | Biotin synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=bioB PE=3 SV=1 | 80 | 397 | 3.0E-103 |
| sp|Q1LTL8|BIOB_BAUCH | Biotin synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=bioB PE=3 SV=1 | 79 | 388 | 4.0E-103 |
| sp|B1ZFX7|BIOB_METPB | Biotin synthase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=bioB PE=3 SV=1 | 78 | 388 | 4.0E-103 |
| sp|Q3SW30|BIOB_NITWN | Biotin synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=bioB PE=3 SV=1 | 77 | 390 | 4.0E-103 |
| sp|Q83CU5|BIOB_COXBU | Biotin synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bioB PE=3 SV=1 | 79 | 388 | 5.0E-103 |
| sp|A9NCS0|BIOB_COXBR | Biotin synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=bioB PE=3 SV=1 | 79 | 388 | 5.0E-103 |
| sp|A9KG71|BIOB_COXBN | Biotin synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=bioB PE=3 SV=1 | 79 | 388 | 5.0E-103 |
| sp|B6J074|BIOB_COXB2 | Biotin synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=bioB PE=3 SV=1 | 79 | 388 | 5.0E-103 |
| sp|B6J725|BIOB_COXB1 | Biotin synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=bioB PE=3 SV=1 | 79 | 388 | 5.0E-103 |
| sp|Q084I8|BIOB_SHEFN | Biotin synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=bioB PE=3 SV=1 | 76 | 388 | 6.0E-103 |
| sp|P44987|BIOB_HAEIN | Biotin synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioB PE=3 SV=1 | 64 | 388 | 7.0E-103 |
| sp|A5UD65|BIOB_HAEIE | Biotin synthase OS=Haemophilus influenzae (strain PittEE) GN=bioB PE=3 SV=1 | 64 | 388 | 7.0E-103 |
| sp|Q4QLQ0|BIOB_HAEI8 | Biotin synthase OS=Haemophilus influenzae (strain 86-028NP) GN=bioB PE=3 SV=1 | 64 | 388 | 7.0E-103 |
| sp|A9W8M8|BIOB_METEP | Biotin synthase OS=Methylobacterium extorquens (strain PA1) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-102 |
| sp|B7KN34|BIOB_METC4 | Biotin synthase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-102 |
| sp|Q12NN4|BIOB_SHEDO | Biotin synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=bioB PE=3 SV=1 | 76 | 388 | 1.0E-102 |
| sp|A5EFG5|BIOB_BRASB | Biotin synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=bioB PE=3 SV=1 | 78 | 394 | 2.0E-102 |
| sp|A6VNF1|BIOB_ACTSZ | Biotin synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=bioB PE=3 SV=1 | 79 | 388 | 2.0E-102 |
| sp|B2SWS5|BIOB_BURPP | Biotin synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=bioB PE=3 SV=1 | 81 | 390 | 3.0E-102 |
| sp|Q21W43|BIOB_RHOFT | Biotin synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=bioB PE=3 SV=1 | 81 | 371 | 3.0E-102 |
| sp|Q146K5|BIOB_BURXL | Biotin synthase OS=Burkholderia xenovorans (strain LB400) GN=bioB PE=3 SV=1 | 81 | 390 | 3.0E-102 |
| sp|Q1LS73|BIOB_CUPMC | Biotin synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=bioB PE=3 SV=2 | 58 | 390 | 3.0E-102 |
| sp|Q2T1Q4|BIOB_BURTA | Biotin synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=bioB PE=3 SV=2 | 77 | 390 | 4.0E-102 |
| sp|A3N520|BIOB_BURP6 | Biotin synthase OS=Burkholderia pseudomallei (strain 668) GN=bioB PE=3 SV=2 | 77 | 390 | 4.0E-102 |
| sp|A1V817|BIOB_BURMS | Biotin synthase OS=Burkholderia mallei (strain SAVP1) GN=bioB PE=3 SV=1 | 77 | 390 | 4.0E-102 |
| sp|Q62MW9|BIOB_BURMA | Biotin synthase OS=Burkholderia mallei (strain ATCC 23344) GN=bioB PE=3 SV=2 | 77 | 390 | 4.0E-102 |
| sp|A2S7R3|BIOB_BURM9 | Biotin synthase OS=Burkholderia mallei (strain NCTC 10229) GN=bioB PE=3 SV=2 | 77 | 390 | 4.0E-102 |
| sp|A3MNG1|BIOB_BURM7 | Biotin synthase OS=Burkholderia mallei (strain NCTC 10247) GN=bioB PE=3 SV=2 | 77 | 390 | 4.0E-102 |
| sp|A4G1F1|BIOB_HERAR | Biotin synthase OS=Herminiimonas arsenicoxydans GN=bioB PE=3 SV=1 | 81 | 388 | 5.0E-102 |
| sp|Q47IF6|BIOB_DECAR | Biotin synthase OS=Dechloromonas aromatica (strain RCB) GN=bioB PE=3 SV=1 | 81 | 391 | 5.0E-102 |
| sp|Q0I355|BIOB_HAES1 | Biotin synthase OS=Haemophilus somnus (strain 129Pt) GN=bioB PE=3 SV=1 | 81 | 388 | 5.0E-102 |
| sp|B1LV19|BIOB_METRJ | Biotin synthase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=bioB PE=3 SV=1 | 76 | 374 | 6.0E-102 |
| sp|Q5HAN0|BIOB_EHRRW | Biotin synthase OS=Ehrlichia ruminantium (strain Welgevonden) GN=bioB PE=3 SV=1 | 78 | 388 | 6.0E-102 |
| sp|Q5FFY2|BIOB_EHRRG | Biotin synthase OS=Ehrlichia ruminantium (strain Gardel) GN=bioB PE=3 SV=1 | 78 | 388 | 7.0E-102 |
| sp|B6JDD7|BIOB_OLICO | Biotin synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=bioB PE=3 SV=1 | 77 | 390 | 1.0E-101 |
| sp|B0UUK6|BIOB_HISS2 | Biotin synthase OS=Histophilus somni (strain 2336) GN=bioB PE=3 SV=1 | 81 | 388 | 1.0E-101 |
| sp|Q0BUV5|BIOB_GRABC | Biotin synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=bioB PE=3 SV=2 | 78 | 388 | 2.0E-101 |
| sp|Q63Y25|BIOB_BURPS | Biotin synthase OS=Burkholderia pseudomallei (strain K96243) GN=bioB PE=3 SV=2 | 77 | 390 | 3.0E-101 |
| sp|A3NQS1|BIOB_BURP0 | Biotin synthase OS=Burkholderia pseudomallei (strain 1106a) GN=bioB PE=3 SV=1 | 77 | 390 | 3.0E-101 |
| sp|Q82SL7|BIOB_NITEU | Biotin synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=bioB PE=3 SV=2 | 81 | 391 | 3.0E-101 |
| sp|Q9CNP8|BIOB_PASMU | Biotin synthase OS=Pasteurella multocida (strain Pm70) GN=bioB PE=3 SV=1 | 81 | 388 | 9.0E-101 |
| sp|A3PDJ8|BIOB_PROM0 | Biotin synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=bioB PE=3 SV=2 | 75 | 395 | 1.0E-100 |
| sp|A6SU66|BIOB_JANMA | Biotin synthase OS=Janthinobacterium sp. (strain Marseille) GN=bioB PE=3 SV=1 | 81 | 388 | 1.0E-100 |
| sp|A8G5G3|BIOB_PROM2 | Biotin synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=bioB PE=3 SV=1 | 75 | 395 | 2.0E-100 |
| sp|Q31AD2|BIOB_PROM9 | Biotin synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=bioB PE=3 SV=1 | 75 | 395 | 2.0E-100 |
| sp|B4E9L4|BIOB_BURCJ | Biotin synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=bioB PE=3 SV=1 | 72 | 390 | 3.0E-100 |
| sp|Q3JWR8|BIOB_BURP1 | Biotin synthase OS=Burkholderia pseudomallei (strain 1710b) GN=bioB PE=3 SV=2 | 77 | 390 | 3.0E-100 |
| sp|Q0KF86|BIOB_CUPNH | Biotin synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=bioB PE=3 SV=1 | 81 | 390 | 4.0E-100 |
| sp|A9AE44|BIOB_BURM1 | Biotin synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=bioB PE=3 SV=1 | 72 | 390 | 4.0E-100 |
| sp|B2AGA0|BIOB_CUPTR | Biotin synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=bioB PE=3 SV=1 | 81 | 390 | 4.0E-100 |
| sp|A1B1Z0|BIOB1_PARDP | Biotin synthase 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=bioB1 PE=3 SV=1 | 78 | 388 | 6.0E-100 |
| sp|Q2Y9Y9|BIOB_NITMU | Biotin synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=bioB PE=3 SV=1 | 81 | 391 | 7.0E-100 |
| sp|Q0AE72|BIOB_NITEC | Biotin synthase OS=Nitrosomonas eutropha (strain C91) GN=bioB PE=3 SV=1 | 75 | 391 | 8.0E-100 |
| sp|A4JIB7|BIOB_BURVG | Biotin synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=bioB PE=3 SV=1 | 72 | 390 | 1.0E-99 |
| sp|A2BRS2|BIOB_PROMS | Biotin synthase OS=Prochlorococcus marinus (strain AS9601) GN=bioB PE=3 SV=1 | 76 | 395 | 2.0E-99 |
| sp|A0KB05|BIOB_BURCH | Biotin synthase OS=Burkholderia cenocepacia (strain HI2424) GN=bioB PE=3 SV=1 | 79 | 390 | 2.0E-99 |
| sp|B1JZE1|BIOB_BURCC | Biotin synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=bioB PE=3 SV=1 | 79 | 390 | 2.0E-99 |
| sp|Q1BT34|BIOB_BURCA | Biotin synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=bioB PE=3 SV=1 | 79 | 390 | 2.0E-99 |
| sp|B1YNS2|BIOB_BURA4 | Biotin synthase OS=Burkholderia ambifaria (strain MC40-6) GN=bioB PE=3 SV=1 | 72 | 390 | 3.0E-99 |
| sp|A4YQS3|BIOB_BRASO | Biotin synthase OS=Bradyrhizobium sp. (strain ORS278) GN=bioB PE=3 SV=1 | 78 | 390 | 5.0E-99 |
| sp|Q4UM45|BIOB_RICFE | Biotin synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=bioB PE=3 SV=1 | 79 | 388 | 6.0E-99 |
| sp|Q477A1|BIOB_CUPPJ | Biotin synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=bioB PE=3 SV=1 | 81 | 390 | 7.0E-99 |
| sp|Q3SLY0|BIOB_THIDA | Biotin synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=bioB PE=3 SV=1 | 85 | 391 | 2.0E-98 |
| sp|A9BB12|BIOB_PROM4 | Biotin synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=bioB PE=3 SV=1 | 78 | 396 | 2.0E-98 |
| sp|Q1QYD5|BIOB_CHRSD | Biotin synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=bioB PE=3 SV=1 | 78 | 388 | 2.0E-98 |
| sp|Q1Q8S6|BIOB_PSYCK | Biotin synthase OS=Psychrobacter cryohalolentis (strain K5) GN=bioB PE=3 SV=1 | 70 | 389 | 3.0E-98 |
| sp|B8F6C9|BIOB_HAEPS | Biotin synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=bioB PE=3 SV=1 | 79 | 391 | 4.0E-98 |
| sp|Q89AK5|BIOB_BUCBP | Biotin synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bioB PE=3 SV=1 | 78 | 389 | 4.0E-98 |
| sp|Q0BBD4|BIOB_BURCM | Biotin synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=bioB PE=3 SV=1 | 61 | 390 | 5.0E-98 |
| sp|Q7NPW1|BIOB_CHRVO | Biotin synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=bioB PE=3 SV=1 | 64 | 391 | 7.0E-98 |
| sp|Q5LN74|BIOB_RUEPO | Biotin synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=bioB PE=3 SV=1 | 74 | 387 | 9.0E-98 |
| sp|Q39CE4|BIOB_BURL3 | Biotin synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=bioB PE=3 SV=1 | 59 | 388 | 2.0E-97 |
| sp|A5GLZ1|BIOB_SYNPW | Biotin synthase OS=Synechococcus sp. (strain WH7803) GN=bioB PE=3 SV=1 | 78 | 390 | 2.0E-97 |
| sp|Q4FQJ9|BIOB_PSYA2 | Biotin synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=bioB PE=3 SV=1 | 81 | 389 | 3.0E-97 |
| sp|A5UIF3|BIOB_HAEIG | Biotin synthase OS=Haemophilus influenzae (strain PittGG) GN=bioB PE=3 SV=1 | 64 | 388 | 4.0E-97 |
| sp|A5WHI6|BIOB_PSYWF | Biotin synthase OS=Psychrobacter sp. (strain PRwf-1) GN=bioB PE=3 SV=1 | 82 | 388 | 4.0E-97 |
| sp|A9LZ69|BIOB_NEIM0 | Biotin synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=bioB PE=3 SV=2 | 81 | 397 | 4.0E-97 |
| sp|Q7V6T8|BIOB_PROMM | Biotin synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=bioB PE=3 SV=1 | 78 | 398 | 7.0E-97 |
| sp|A2C8D5|BIOB_PROM3 | Biotin synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=bioB PE=3 SV=1 | 78 | 398 | 8.0E-97 |
| sp|A2SGQ6|BIOB_METPP | Biotin synthase OS=Methylibium petroleiphilum (strain PM1) GN=bioB PE=3 SV=1 | 66 | 390 | 8.0E-97 |
| sp|Q2GDF4|BIOB_NEOSM | Biotin synthase OS=Neorickettsia sennetsu (strain Miyayama) GN=bioB PE=3 SV=2 | 81 | 379 | 9.0E-97 |
| sp|B9J9I5|BIOB_AGRRK | Biotin synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=bioB PE=3 SV=2 | 78 | 387 | 1.0E-96 |
| sp|A1KU01|BIOB_NEIMF | Biotin synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=bioB PE=3 SV=2 | 81 | 397 | 2.0E-96 |
| sp|Q3AJ51|BIOB_SYNSC | Biotin synthase OS=Synechococcus sp. (strain CC9605) GN=bioB PE=3 SV=1 | 78 | 390 | 3.0E-96 |
| sp|B8EMZ5|BIOB_METSB | Biotin synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=bioB PE=3 SV=1 | 78 | 383 | 3.0E-96 |
| sp|Q7U7P8|BIOB_SYNPX | Biotin synthase OS=Synechococcus sp. (strain WH8102) GN=bioB PE=3 SV=1 | 78 | 390 | 6.0E-96 |
| sp|A9I023|BIOB_BORPD | Biotin synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=bioB PE=3 SV=1 | 81 | 390 | 1.0E-95 |
| sp|A1IRY3|BIOB_NEIMA | Biotin synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=bioB PE=3 SV=1 | 81 | 397 | 1.0E-95 |
| sp|B4RLI6|BIOB_NEIG2 | Biotin synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=bioB PE=3 SV=2 | 81 | 397 | 2.0E-95 |
| sp|Q5F8G2|BIOB_NEIG1 | Biotin synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=bioB PE=3 SV=1 | 81 | 397 | 2.0E-95 |
| sp|Q9JRW7|BIOB_NEIMB | Biotin synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=bioB1 PE=3 SV=1 | 81 | 397 | 2.0E-95 |
| sp|A5GS37|BIOB_SYNR3 | Biotin synthase OS=Synechococcus sp. (strain RCC307) GN=bioB PE=3 SV=1 | 78 | 371 | 3.0E-95 |
| sp|A3MYI9|BIOB_ACTP2 | Biotin synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=bioB PE=3 SV=1 | 79 | 398 | 7.0E-95 |
| sp|B0BS22|BIOB_ACTPJ | Biotin synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=bioB PE=3 SV=1 | 79 | 398 | 7.0E-95 |
| sp|B3GZV8|BIOB_ACTP7 | Biotin synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=bioB PE=3 SV=1 | 79 | 398 | 7.0E-95 |
| sp|Q3AX82|BIOB_SYNS9 | Biotin synthase OS=Synechococcus sp. (strain CC9902) GN=bioB PE=3 SV=1 | 78 | 390 | 1.0E-94 |
| sp|Q7WB85|BIOB_BORPA | Biotin synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bioB PE=3 SV=1 | 81 | 390 | 1.0E-94 |
| sp|Q7WMQ3|BIOB_BORBR | Biotin synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bioB PE=3 SV=1 | 81 | 390 | 1.0E-94 |
| sp|Q7VBJ0|BIOB_PROMA | Biotin synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=bioB PE=3 SV=1 | 78 | 390 | 3.0E-94 |
| sp|Q7VVF1|BIOB_BORPE | Biotin synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bioB PE=3 SV=2 | 81 | 390 | 4.0E-94 |
| sp|B0U0S3|BIOB_FRAP2 | Biotin synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=bioB PE=3 SV=1 | 82 | 388 | 5.0E-94 |
| sp|Q12F39|BIOB1_POLSJ | Biotin synthase 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=bioB1 PE=3 SV=1 | 74 | 389 | 5.0E-94 |
| sp|Q5NGB2|BIOB_FRATT | Biotin synthase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=bioB PE=3 SV=1 | 82 | 390 | 6.0E-94 |
| sp|Q14HR4|BIOB_FRAT1 | Biotin synthase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=bioB PE=3 SV=1 | 82 | 390 | 6.0E-94 |
| sp|A4IXP5|BIOB_FRATW | Biotin synthase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=bioB PE=3 SV=1 | 82 | 390 | 1.0E-93 |
| sp|A0Q638|BIOB_FRATN | Biotin synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=bioB PE=3 SV=1 | 82 | 390 | 1.0E-93 |
| sp|A9C2R2|BIOB_DELAS | Biotin synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=bioB PE=3 SV=1 | 81 | 397 | 1.0E-93 |
| sp|Q7VMH0|BIOB_HAEDU | Biotin synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=bioB PE=3 SV=1 | 79 | 395 | 2.0E-93 |
| sp|Q0BLD5|BIOB_FRATO | Biotin synthase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=bioB PE=3 SV=1 | 82 | 390 | 2.0E-93 |
| sp|Q2A2V9|BIOB_FRATH | Biotin synthase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=bioB PE=3 SV=1 | 82 | 390 | 2.0E-93 |
| sp|A7NCW7|BIOB_FRATF | Biotin synthase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=bioB PE=3 SV=1 | 82 | 390 | 2.0E-93 |
| sp|Q7V101|BIOB_PROMP | Biotin synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=bioB PE=3 SV=1 | 76 | 398 | 3.0E-93 |
| sp|B2SGE3|BIOB_FRATM | Biotin synthase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=bioB PE=3 SV=1 | 82 | 390 | 3.0E-93 |
| sp|A1TQ53|BIOB_ACIAC | Biotin synthase OS=Acidovorax citrulli (strain AAC00-1) GN=bioB PE=3 SV=1 | 81 | 389 | 6.0E-93 |
| sp|A3PH74|BIOB_RHOS1 | Biotin synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=bioB PE=3 SV=1 | 78 | 388 | 8.0E-93 |
| sp|Q3J561|BIOB_RHOS4 | Biotin synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=bioB PE=3 SV=1 | 78 | 388 | 8.0E-93 |
| sp|A8IJU8|BIOB_AZOC5 | Biotin synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=bioB PE=3 SV=1 | 88 | 388 | 1.0E-92 |
| sp|A1W7J6|BIOB_ACISJ | Biotin synthase OS=Acidovorax sp. (strain JS42) GN=bioB PE=3 SV=1 | 81 | 388 | 1.0E-92 |
| sp|A2BX80|BIOB_PROM5 | Biotin synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=bioB PE=3 SV=1 | 78 | 398 | 1.0E-92 |
| sp|B9KM96|BIOB_RHOSK | Biotin synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=bioB PE=3 SV=1 | 78 | 388 | 1.0E-91 |
| sp|B9MJH4|BIOB_ACIET | Biotin synthase OS=Acidovorax ebreus (strain TPSY) GN=bioB PE=3 SV=1 | 81 | 388 | 2.0E-91 |
| sp|Q0IBC8|BIOB_SYNS3 | Biotin synthase OS=Synechococcus sp. (strain CC9311) GN=bioB PE=3 SV=2 | 74 | 390 | 3.0E-89 |
| sp|P94966|BIOB_METSK | Biotin synthase OS=Methylobacillus sp. (strain KT1) GN=bioB PE=3 SV=2 | 65 | 391 | 3.0E-87 |
| sp|B3DV36|BIOB_METI4 | Biotin synthase OS=Methylacidiphilum infernorum (isolate V4) GN=bioB PE=3 SV=2 | 86 | 388 | 2.0E-83 |
| sp|B9E2A2|BIOB_CLOK1 | Biotin synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=bioB PE=3 SV=1 | 96 | 397 | 2.0E-67 |
| sp|B2UNW0|BIOB_AKKM8 | Biotin synthase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=bioB PE=3 SV=1 | 82 | 387 | 2.0E-61 |
| sp|Q899M1|BIOB_CLOTE | Biotin synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=bioB PE=3 SV=1 | 90 | 389 | 1.0E-60 |
| sp|A7I1A0|BIOB_CAMHC | Biotin synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=bioB PE=3 SV=1 | 93 | 395 | 1.0E-59 |
| sp|A0PYU9|BIOB_CLONN | Biotin synthase OS=Clostridium novyi (strain NT) GN=bioB PE=3 SV=1 | 100 | 390 | 3.0E-59 |
| sp|A9A5K6|BIOB_NITMS | Biotin synthase OS=Nitrosopumilus maritimus (strain SCM1) GN=bioB PE=3 SV=1 | 89 | 390 | 4.0E-59 |
| sp|A3DBD3|BIOB_CLOTH | Biotin synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bioB PE=3 SV=1 | 113 | 388 | 3.0E-57 |
| sp|Q3ADP5|BIOB_CARHZ | Biotin synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=bioB PE=3 SV=1 | 94 | 388 | 4.0E-57 |
| sp|B0TE53|BIOB_HELMI | Biotin synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=bioB PE=3 SV=1 | 71 | 389 | 3.0E-56 |
| sp|Q8XK59|BIOB_CLOPE | Biotin synthase OS=Clostridium perfringens (strain 13 / Type A) GN=bioB PE=3 SV=1 | 81 | 394 | 7.0E-56 |
| sp|Q6NHL3|BIOB2_CORDI | Biotin synthase 2 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=bioB2 PE=3 SV=1 | 82 | 389 | 1.0E-55 |
| sp|Q18D35|BIOB_PEPD6 | Biotin synthase OS=Peptoclostridium difficile (strain 630) GN=bioB PE=3 SV=1 | 106 | 388 | 2.0E-55 |
| sp|C6C0T2|BIOB_DESAD | Biotin synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=bioB PE=3 SV=1 | 94 | 389 | 1.0E-54 |
| sp|Q0TQ59|BIOB_CLOP1 | Biotin synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=bioB PE=3 SV=1 | 81 | 394 | 2.0E-54 |
| sp|A6TT61|BIOB_ALKMQ | Biotin synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=bioB PE=3 SV=1 | 94 | 388 | 3.0E-54 |
| sp|A5D4Y6|BIOB_PELTS | Biotin synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=bioB PE=3 SV=1 | 94 | 391 | 3.0E-53 |
| sp|Q3INU3|BIOB_NATPD | Biotin synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=bioB PE=3 SV=1 | 88 | 397 | 1.0E-52 |
| sp|B1WTI3|BIOB_CYAA5 | Biotin synthase OS=Cyanothece sp. (strain ATCC 51142) GN=bioB PE=3 SV=2 | 114 | 388 | 1.0E-52 |
| sp|B1XNE1|BIOB_SYNP2 | Biotin synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bioB PE=3 SV=1 | 114 | 388 | 2.0E-52 |
| sp|O67104|BIOB_AQUAE | Biotin synthase OS=Aquifex aeolicus (strain VF5) GN=bioB PE=3 SV=1 | 91 | 343 | 3.0E-52 |
| sp|B1I4G4|BIOB_DESAP | Biotin synthase OS=Desulforudis audaxviator (strain MP104C) GN=bioB PE=3 SV=1 | 101 | 388 | 3.0E-52 |
| sp|Q8REU0|BIOB_FUSNN | Biotin synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=bioB PE=3 SV=1 | 114 | 365 | 4.0E-52 |
| sp|C0QVM0|BIOB_BRAHW | Biotin synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=bioB PE=3 SV=1 | 67 | 387 | 5.0E-52 |
| sp|A0LTP8|BIOB_ACIC1 | Biotin synthase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=bioB PE=3 SV=1 | 62 | 370 | 2.0E-51 |
| sp|B0JFP4|BIOB_MICAN | Biotin synthase OS=Microcystis aeruginosa (strain NIES-843) GN=bioB PE=3 SV=1 | 114 | 388 | 2.0E-51 |
| sp|B7K1U3|BIOB_CYAP8 | Biotin synthase OS=Cyanothece sp. (strain PCC 8801) GN=bioB PE=3 SV=1 | 114 | 388 | 3.0E-51 |
| sp|Q6AK48|BIOB_DESPS | Biotin synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=bioB PE=3 SV=1 | 94 | 389 | 4.0E-51 |
| sp|A0RW96|BIOB_CENSY | Biotin synthase OS=Cenarchaeum symbiosum (strain A) GN=bioB PE=3 SV=1 | 80 | 390 | 1.0E-50 |
| sp|B8HPP0|BIOB_CYAP4 | Biotin synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=bioB PE=3 SV=2 | 114 | 388 | 3.0E-50 |
| sp|Q10YQ3|BIOB_TRIEI | Biotin synthase OS=Trichodesmium erythraeum (strain IMS101) GN=bioB PE=3 SV=1 | 114 | 388 | 3.0E-50 |
| sp|A4J1M3|BIOB_DESRM | Biotin synthase OS=Desulfotomaculum reducens (strain MI-1) GN=bioB PE=3 SV=1 | 113 | 389 | 3.0E-50 |
| sp|A7GFJ9|BIOB_CLOBL | Biotin synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=bioB PE=3 SV=1 | 112 | 388 | 4.0E-50 |
| sp|B7KFJ9|BIOB_CYAP7 | Biotin synthase OS=Cyanothece sp. (strain PCC 7424) GN=bioB PE=3 SV=1 | 113 | 388 | 4.0E-50 |
| sp|Q728P5|BIOB_DESVH | Biotin synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=bioB PE=3 SV=2 | 106 | 390 | 6.0E-50 |
| sp|B9KBR9|BIOB_THENN | Biotin synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=bioB PE=3 SV=1 | 113 | 382 | 7.0E-50 |
| sp|A5I427|BIOB_CLOBH | Biotin synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=bioB PE=3 SV=1 | 112 | 388 | 8.0E-50 |
| sp|A7FVS6|BIOB_CLOB1 | Biotin synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=bioB PE=3 SV=1 | 112 | 388 | 8.0E-50 |
| sp|A1VB97|BIOB_DESVV | Biotin synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=bioB PE=3 SV=1 | 106 | 390 | 8.0E-50 |
| sp|B1KW08|BIOB_CLOBM | Biotin synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=bioB PE=3 SV=1 | 96 | 388 | 1.0E-49 |
| sp|B2TL73|BIOB_CLOBB | Biotin synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=bioB PE=3 SV=1 | 65 | 388 | 1.0E-49 |
| sp|B1IHH9|BIOB_CLOBK | Biotin synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=bioB PE=3 SV=1 | 112 | 388 | 2.0E-49 |
| sp|B2V167|BIOB_CLOBA | Biotin synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=bioB PE=3 SV=1 | 113 | 388 | 2.0E-49 |
| sp|A5IK57|BIOB_THEP1 | Biotin synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=bioB PE=3 SV=1 | 113 | 382 | 2.0E-49 |
| sp|A0LJA8|BIOB_SYNFM | Biotin synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=bioB PE=3 SV=1 | 68 | 365 | 3.0E-49 |
| sp|B5ECN1|BIOB_GEOBB | Biotin synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=bioB PE=3 SV=1 | 113 | 388 | 5.0E-49 |
| sp|B2V8G9|BIOB_SULSY | Biotin synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=bioB PE=3 SV=1 | 85 | 358 | 9.0E-49 |
| sp|A6LUQ4|BIOB_CLOB8 | Biotin synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=bioB PE=3 SV=1 | 114 | 389 | 1.0E-48 |
| sp|Q740Q9|BIOB_MYCPA | Biotin synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=bioB PE=3 SV=1 | 113 | 370 | 2.0E-48 |
| sp|Q7M8P7|BIOB_WOLSU | Biotin synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=bioB PE=3 SV=1 | 114 | 388 | 4.0E-48 |
| sp|A0QHJ1|BIOB_MYCA1 | Biotin synthase OS=Mycobacterium avium (strain 104) GN=bioB PE=3 SV=1 | 113 | 370 | 4.0E-48 |
| sp|B5YK85|BIOB_THEYD | Biotin synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=bioB PE=3 SV=1 | 90 | 371 | 5.0E-48 |
| sp|Q0SHW6|BIOB_RHOJR | Biotin synthase OS=Rhodococcus jostii (strain RHA1) GN=bioB PE=3 SV=2 | 91 | 379 | 5.0E-48 |
| sp|B3E599|BIOB_GEOLS | Biotin synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=bioB PE=3 SV=1 | 106 | 368 | 6.0E-48 |
| sp|P73538|BIOB_SYNY3 | Biotin synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=bioB PE=3 SV=1 | 114 | 388 | 2.0E-47 |
| sp|Q7MT97|BIOB_PORGI | Biotin synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=bioB PE=3 SV=1 | 92 | 371 | 2.0E-47 |
| sp|A4X585|BIOB_SALTO | Biotin synthase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=bioB PE=3 SV=1 | 95 | 370 | 3.0E-47 |
| sp|B9M305|BIOB_GEODF | Biotin synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=bioB PE=3 SV=1 | 89 | 371 | 3.0E-47 |
| sp|Q3A4K3|BIOB_PELCD | Biotin synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=bioB PE=3 SV=1 | 114 | 392 | 4.0E-47 |
| sp|B4U973|BIOB_HYDS0 | Biotin synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=bioB PE=3 SV=1 | 91 | 359 | 5.0E-47 |
| sp|Q8FUD1|BIOB_COREF | Biotin synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=bioB PE=3 SV=1 | 94 | 388 | 5.0E-47 |
| sp|Q5YYR3|BIOB_NOCFA | Biotin synthase OS=Nocardia farcinica (strain IFM 10152) GN=bioB PE=3 SV=1 | 91 | 385 | 6.0E-47 |
| sp|Q0RD46|BIOB_FRAAA | Biotin synthase OS=Frankia alni (strain ACN14a) GN=bioB PE=3 SV=1 | 90 | 370 | 7.0E-47 |
| sp|Q6NKC7|BIOB1_CORDI | Biotin synthase 1 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=bioB1 PE=3 SV=1 | 94 | 385 | 2.0E-46 |
| sp|Q4JWG3|BIOB_CORJK | Biotin synthase OS=Corynebacterium jeikeium (strain K411) GN=bioB PE=3 SV=1 | 90 | 388 | 2.0E-46 |
| sp|A0QX70|BIOB_MYCS2 | Biotin synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=bioB PE=3 SV=1 | 94 | 370 | 2.0E-46 |
| sp|B2RH08|BIOB_PORG3 | Biotin synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=bioB PE=3 SV=2 | 92 | 371 | 2.0E-46 |
| sp|Q97MI6|BIOB_CLOAB | Biotin synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bioB PE=3 SV=1 | 97 | 383 | 4.0E-46 |
| sp|Q3ANX4|BIOB_CHLCH | Biotin synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=bioB PE=3 SV=1 | 72 | 370 | 4.0E-46 |
| sp|A0L3M0|BIOB_MAGMM | Biotin synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=bioB PE=3 SV=1 | 93 | 371 | 5.0E-46 |
| sp|Q74CT7|BIOB_GEOSL | Biotin synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioB PE=3 SV=1 | 114 | 389 | 6.0E-46 |
| sp|Q30XZ5|BIOB_DESAG | Biotin synthase OS=Desulfovibrio alaskensis (strain G20) GN=bioB PE=3 SV=1 | 85 | 388 | 7.0E-46 |
| sp|A5G3Q7|BIOB_GEOUR | Biotin synthase OS=Geobacter uraniireducens (strain Rf4) GN=bioB PE=3 SV=1 | 57 | 390 | 8.0E-46 |
| sp|B1GYW9|BIOB_UNCTG | Biotin synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=bioB PE=3 SV=1 | 65 | 388 | 1.0E-45 |
| sp|Q7UF84|BIOB_RHOBA | Biotin synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=bioB PE=3 SV=1 | 105 | 396 | 1.0E-45 |
| sp|B1MBZ3|BIOB_MYCA9 | Biotin synthase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=bioB PE=3 SV=1 | 91 | 370 | 1.0E-45 |
| sp|A8LUR1|BIOB_SALAI | Biotin synthase OS=Salinispora arenicola (strain CNS-205) GN=bioB PE=3 SV=1 | 95 | 370 | 2.0E-45 |
| sp|Q72L21|BIOB_THET2 | Biotin synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=bioB PE=3 SV=1 | 113 | 388 | 2.0E-45 |
| sp|A4T9L9|BIOB_MYCGI | Biotin synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=bioB PE=3 SV=1 | 94 | 370 | 2.0E-45 |
| sp|Q2IF61|BIOB_ANADE | Biotin synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=bioB PE=3 SV=1 | 84 | 389 | 2.0E-45 |
| sp|B4S690|BIOB_PROA2 | Biotin synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=bioB PE=3 SV=1 | 92 | 382 | 3.0E-45 |
| sp|B8FHQ1|BIOB_DESAA | Biotin synthase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=bioB PE=3 SV=1 | 68 | 395 | 4.0E-45 |
| sp|B3QLR7|BIOB_CHLP8 | Biotin synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=bioB PE=3 SV=1 | 94 | 385 | 4.0E-45 |
| sp|Q8KGB6|BIOB_CHLTE | Biotin synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=bioB PE=3 SV=1 | 94 | 370 | 6.0E-45 |
| sp|A1AN77|BIOB_PELPD | Biotin synthase OS=Pelobacter propionicus (strain DSM 2379) GN=bioB PE=3 SV=1 | 97 | 388 | 6.0E-45 |
| sp|B2HQ93|BIOB_MYCMM | Biotin synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=bioB PE=3 SV=1 | 85 | 370 | 7.0E-45 |
| sp|Q5SKN6|BIOB_THET8 | Biotin synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=bioB PE=3 SV=1 | 113 | 383 | 9.0E-45 |
| sp|Q2LY09|BIOB_SYNAS | Biotin synthase OS=Syntrophus aciditrophicus (strain SB) GN=bioB PE=3 SV=1 | 53 | 370 | 1.0E-44 |
| sp|A1T8V0|BIOB_MYCVP | Biotin synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=bioB PE=3 SV=1 | 114 | 370 | 1.0E-44 |
| sp|A8EWX7|BIOB_ARCB4 | Biotin synthase OS=Arcobacter butzleri (strain RM4018) GN=bioB PE=3 SV=1 | 112 | 370 | 1.0E-44 |
| sp|A0PP05|BIOB_MYCUA | Biotin synthase OS=Mycobacterium ulcerans (strain Agy99) GN=bioB PE=3 SV=1 | 85 | 370 | 1.0E-44 |
| sp|P46715|BIOB_MYCLE | Biotin synthase OS=Mycobacterium leprae (strain TN) GN=bioB PE=3 SV=2 | 82 | 370 | 1.0E-44 |
| sp|B8ZR86|BIOB_MYCLB | Biotin synthase OS=Mycobacterium leprae (strain Br4923) GN=bioB PE=3 SV=1 | 82 | 370 | 1.0E-44 |
| sp|P9WPQ7|BIOB_MYCTU | Biotin synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioB PE=1 SV=1 | 91 | 370 | 1.0E-44 |
| sp|P9WPQ6|BIOB_MYCTO | Biotin synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioB PE=3 SV=1 | 91 | 370 | 1.0E-44 |
| sp|A5WMR0|BIOB_MYCTF | Biotin synthase OS=Mycobacterium tuberculosis (strain F11) GN=bioB PE=3 SV=1 | 91 | 370 | 1.0E-44 |
| sp|A5U2U5|BIOB_MYCTA | Biotin synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=bioB PE=3 SV=1 | 91 | 370 | 1.0E-44 |
| sp|A1KJ05|BIOB_MYCBP | Biotin synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=bioB PE=3 SV=1 | 91 | 370 | 1.0E-44 |
| sp|P0A507|BIOB_MYCBO | Biotin synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=bioB PE=3 SV=1 | 91 | 370 | 1.0E-44 |
| sp|A4SGW2|BIOB_CHLPM | Biotin synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=bioB PE=3 SV=2 | 95 | 370 | 2.0E-44 |
| sp|A1BCQ5|BIOB_CHLPD | Biotin synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=bioB PE=3 SV=2 | 94 | 370 | 2.0E-44 |
| sp|Q2S4I8|BIOB_SALRD | Biotin synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=bioB PE=3 SV=1 | 118 | 388 | 2.0E-44 |
| sp|Q8KZM7|BIOB_BACNA | Biotin synthase OS=Bacillus subtilis subsp. natto GN=bioB PE=3 SV=1 | 80 | 388 | 2.0E-44 |
| sp|Q2J6H8|BIOB1_FRASC | Biotin synthase 1 OS=Frankia sp. (strain CcI3) GN=bioB1 PE=3 SV=1 | 94 | 388 | 2.0E-44 |
| sp|B8J638|BIOB_ANAD2 | Biotin synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=bioB PE=3 SV=1 | 84 | 389 | 4.0E-44 |
| sp|A7Z5B2|BIOB_BACMF | Biotin synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=bioB PE=3 SV=1 | 64 | 401 | 4.0E-44 |
| sp|Q70JZ1|BIOB_BACAM | Biotin synthase OS=Bacillus amyloliquefaciens GN=bioB PE=3 SV=1 | 64 | 401 | 4.0E-44 |
| sp|P53557|BIOB_BACSU | Biotin synthase OS=Bacillus subtilis (strain 168) GN=bioB PE=3 SV=1 | 80 | 388 | 5.0E-44 |
| sp|B4UCB2|BIOB_ANASK | Biotin synthase OS=Anaeromyxobacter sp. (strain K) GN=bioB PE=3 SV=1 | 84 | 389 | 5.0E-44 |
| sp|P46396|BIOB_CORGL | Biotin synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=bioB PE=3 SV=3 | 94 | 388 | 1.0E-43 |
| sp|A4QA10|BIOB_CORGB | Biotin synthase OS=Corynebacterium glutamicum (strain R) GN=bioB PE=3 SV=1 | 94 | 388 | 1.0E-43 |
| sp|Q8DL38|BIOB_THEEB | Biotin synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=bioB PE=3 SV=1 | 82 | 398 | 2.0E-43 |
| sp|Q7VFE6|BIOB_HELHP | Biotin synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=bioB PE=3 SV=1 | 113 | 390 | 2.0E-43 |
| sp|B8DPP9|BIOB_DESVM | Biotin synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=bioB PE=3 SV=1 | 117 | 388 | 3.0E-43 |
| sp|Q8A7T2|BIOAB_BACTN | Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=bioB PE=3 SV=2 | 113 | 383 | 3.0E-43 |
| sp|C0QR28|BIOB_PERMH | Biotin synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=bioB PE=3 SV=1 | 95 | 359 | 6.0E-43 |
| sp|Q1CRM5|BIOB_HELPH | Biotin synthase OS=Helicobacter pylori (strain HPAG1) GN=bioB PE=3 SV=1 | 113 | 393 | 7.0E-43 |
| sp|B5Z928|BIOB_HELPG | Biotin synthase OS=Helicobacter pylori (strain G27) GN=bioB PE=3 SV=1 | 113 | 389 | 7.0E-43 |
| sp|Q3B169|BIOB_CHLL7 | Biotin synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=bioB PE=3 SV=2 | 95 | 370 | 1.0E-42 |
| sp|O25956|BIOB_HELPY | Biotin synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bioB PE=3 SV=1 | 113 | 393 | 1.0E-42 |
| sp|Q818X3|BIOB_BACCR | Biotin synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=bioB PE=3 SV=1 | 94 | 398 | 2.0E-42 |
| sp|Q1B7F4|BIOB_MYCSS | Biotin synthase OS=Mycobacterium sp. (strain MCS) GN=bioB PE=3 SV=1 | 114 | 370 | 2.0E-42 |
| sp|A1UHL9|BIOB_MYCSK | Biotin synthase OS=Mycobacterium sp. (strain KMS) GN=bioB PE=3 SV=1 | 114 | 370 | 2.0E-42 |
| sp|A3Q142|BIOB_MYCSJ | Biotin synthase OS=Mycobacterium sp. (strain JLS) GN=bioB PE=3 SV=1 | 114 | 370 | 2.0E-42 |
| sp|Q65MK9|BIOB_BACLD | Biotin synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=bioB PE=3 SV=1 | 94 | 388 | 2.0E-42 |
| sp|B0CC69|BIOB_ACAM1 | Biotin synthase OS=Acaryochloris marina (strain MBIC 11017) GN=bioB PE=3 SV=1 | 113 | 378 | 2.0E-42 |
| sp|B7GKT8|BIOB_ANOFW | Biotin synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioB PE=3 SV=2 | 80 | 370 | 2.0E-42 |
| sp|E6SRG2|BIOAB_BACT6 | Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / P 36-108) GN=bioB PE=3 SV=1 | 113 | 383 | 2.0E-42 |
| sp|B2UVE8|BIOB_HELPS | Biotin synthase OS=Helicobacter pylori (strain Shi470) GN=bioB PE=3 SV=1 | 113 | 393 | 3.0E-42 |
| sp|A7HG97|BIOB_ANADF | Biotin synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=bioB PE=3 SV=1 | 113 | 368 | 4.0E-42 |
| sp|A9VG53|BIOB_BACWK | Biotin synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=bioB PE=3 SV=1 | 94 | 398 | 4.0E-42 |
| sp|B1VF77|BIOB_CORU7 | Biotin synthase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=bioB PE=3 SV=1 | 113 | 388 | 5.0E-42 |
| sp|Q9KC26|BIOB_BACHD | Biotin synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioB PE=3 SV=1 | 82 | 403 | 6.0E-42 |
| sp|Q9ZJK8|BIOB_HELPJ | Biotin synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bioB PE=3 SV=1 | 113 | 393 | 6.0E-42 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003824 | catalytic activity | Yes |
| GO:0051536 | iron-sulfur cluster binding | Yes |
| GO:0003674 | molecular_function | No |
| GO:0005488 | binding | No |
| GO:0051540 | metal cluster binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 22 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauB2|6708 MALGRRLAAVSLFKAARLAGAAVHRGATWPQSRTTWARTGATLVDRPTADDKMVLGESTRRAEAERILREAVAAK EPRQDWTRHEISAIYYQPLLELAHQASTLHRRFHPPGKVQLCTLMNIKTGGCTEDCSYCAQSTRYQKGTGVEAKR VESVESVLAAARKARDKGSTRFCMGAAWRDMRGRKNSLSNITAMVRQVRAMGMEVCVTLGMIDGVQARQLKEAGL TAYNHNVDTSREFYPSVISTRSYDERLATLRHVRDAGLRVCSGGILGLGESSEDRVGLLYTLATLPQHPESFPVN ALVPIKGTPLEDAAPVAFTSILRTVATARILMPRTIIRIAAGRNTMAEEKQALCFMAGANAVFTGEKMLTTDCNS WDQDSAMFGRWGLTAMRSFEQEDGGQGQ* |
| Coding | >OphauB2|6708 ATGGCCTTGGGGCGGCGCTTGGCTGCAGTGAGTCTCTTCAAGGCAGCGCGCCTAGCAGGGGCTGCTGTGCATCGT GGAGCAACATGGCCGCAGAGCCGGACCACCTGGGCGCGCACGGGTGCGACGCTGGTGGACAGGCCTACGGCAGAT GACAAAATGGTGCTGGGCGAGTCGACGCGGCGGGCCGAGGCTGAGCGCATCCTGCGAGAGGCAGTGGCTGCCAAG GAGCCCCGACAGGACTGGACGCGACACGAGATTTCGGCCATTTACTACCAGCCGCTGCTGGAGCTGGCGCATCAG GCGAGCACCCTACACCGGCGCTTCCACCCCCCCGGCAAAGTGCAGCTCTGCACGCTCATGAACATCAAGACGGGC GGCTGCACCGAAGACTGCTCCTACTGCGCGCAGTCGACGCGCTACCAAAAGGGCACCGGGGTTGAGGCCAAGCGC GTGGAGAGTGTAGAGAGCGTGCTGGCAGCAGCGCGCAAGGCACGGGACAAGGGCAGCACGCGCTTCTGCATGGGG GCTGCGTGGCGCGACATGCGCGGACGCAAAAACAGCCTCAGCAACATCACGGCCATGGTGCGCCAAGTACGGGCC ATGGGCATGGAGGTTTGCGTGACGCTGGGCATGATTGACGGAGTGCAGGCGCGCCAGCTCAAGGAGGCGGGACTG ACGGCCTACAACCACAATGTCGACACGAGCCGCGAGTTCTACCCCTCGGTCATCTCGACGCGCTCCTACGACGAG CGCCTCGCCACGCTGCGCCATGTCCGCGACGCTGGCCTCCGCGTCTGCTCGGGCGGCATCCTGGGACTGGGCGAG TCGTCCGAGGACCGCGTTGGCCTGCTCTACACCCTCGCCACTCTGCCCCAGCACCCCGAGAGCTTCCCCGTCAAT GCCCTGGTGCCCATCAAGGGCACGCCGCTCGAGGATGCTGCCCCCGTGGCCTTTACCAGCATCCTACGCACCGTT GCCACGGCCCGCATCCTCATGCCCAGAACCATTATCCGCATTGCTGCCGGCCGCAACACCATGGCCGAGGAGAAG CAGGCCCTGTGCTTCATGGCCGGCGCCAATGCCGTCTTTACCGGCGAAAAGATGCTCACCACCGACTGCAACAGC TGGGACCAAGACAGCGCCATGTTTGGCCGCTGGGGGCTGACTGCCATGCGCAGCTTTGAGCAAGAAGACGGTGGC CAAGGCCAATAG |
| Transcript | >OphauB2|6708 ATGGCCTTGGGGCGGCGCTTGGCTGCAGTGAGTCTCTTCAAGGCAGCGCGCCTAGCAGGGGCTGCTGTGCATCGT GGAGCAACATGGCCGCAGAGCCGGACCACCTGGGCGCGCACGGGTGCGACGCTGGTGGACAGGCCTACGGCAGAT GACAAAATGGTGCTGGGCGAGTCGACGCGGCGGGCCGAGGCTGAGCGCATCCTGCGAGAGGCAGTGGCTGCCAAG GAGCCCCGACAGGACTGGACGCGACACGAGATTTCGGCCATTTACTACCAGCCGCTGCTGGAGCTGGCGCATCAG GCGAGCACCCTACACCGGCGCTTCCACCCCCCCGGCAAAGTGCAGCTCTGCACGCTCATGAACATCAAGACGGGC GGCTGCACCGAAGACTGCTCCTACTGCGCGCAGTCGACGCGCTACCAAAAGGGCACCGGGGTTGAGGCCAAGCGC GTGGAGAGTGTAGAGAGCGTGCTGGCAGCAGCGCGCAAGGCACGGGACAAGGGCAGCACGCGCTTCTGCATGGGG GCTGCGTGGCGCGACATGCGCGGACGCAAAAACAGCCTCAGCAACATCACGGCCATGGTGCGCCAAGTACGGGCC ATGGGCATGGAGGTTTGCGTGACGCTGGGCATGATTGACGGAGTGCAGGCGCGCCAGCTCAAGGAGGCGGGACTG ACGGCCTACAACCACAATGTCGACACGAGCCGCGAGTTCTACCCCTCGGTCATCTCGACGCGCTCCTACGACGAG CGCCTCGCCACGCTGCGCCATGTCCGCGACGCTGGCCTCCGCGTCTGCTCGGGCGGCATCCTGGGACTGGGCGAG TCGTCCGAGGACCGCGTTGGCCTGCTCTACACCCTCGCCACTCTGCCCCAGCACCCCGAGAGCTTCCCCGTCAAT GCCCTGGTGCCCATCAAGGGCACGCCGCTCGAGGATGCTGCCCCCGTGGCCTTTACCAGCATCCTACGCACCGTT GCCACGGCCCGCATCCTCATGCCCAGAACCATTATCCGCATTGCTGCCGGCCGCAACACCATGGCCGAGGAGAAG CAGGCCCTGTGCTTCATGGCCGGCGCCAATGCCGTCTTTACCGGCGAAAAGATGCTCACCACCGACTGCAACAGC TGGGACCAAGACAGCGCCATGTTTGGCCGCTGGGGGCTGACTGCCATGCGCAGCTTTGAGCAAGAAGACGGTGGC CAAGGCCAATAG |
| Gene | >OphauB2|6708 ATGGCCTTGGGGCGGCGCTTGGCTGCAGTGAGTCTCTTCAAGGCAGCGCGCCTAGCAGGGGCTGCTGTGCATCGT GGAGCAACATGGCCGCAGAGCCGGACCACCTGGGCGCGCACGGGTGCGACGCTGGTGGACAGGCCTACGGCAGAT GACAAAATGGTGCTGGGCGAGTCGACGCGGCGGGCCGAGGCTGAGCGCATCCTGCGAGAGGCAGTGGCTGCCAAG GAGCCCCGACAGGACTGGACGCGACACGAGATTTCGGCCATTTACTACCAGCCGCTGCTGGAGCTGGCGCATCAG GCGGTAAGTGGCGAGAGAAGAGAGGGTAGTGGGGAGATGCAGAGAGAATGGTGGTGACGAGGCGAGGCGAGGCGA GGAGAGGAGAGGAGAGGAGGGGAGAGGAGAAGAGGAAGGAAAGGAAAAAAAAAAGATGGTGGCGAAAAAGATGGT GGCTCAAAAAATATAGTGGCTAAAAAGGCTTGCAGAGCACCCTACACCGGCGCTTCCACCCCCCCGGCAAAGTGC AGCTCTGCACGCTCATGAACATCAAGACGGGCGGCTGCACCGAAGACTGCTCCTACTGCGCGCAGTCGACGCGCT ACCAAAAGGGCACCGGGGTTGAGGCCAAGCGCGTGGAGAGTGTAGAGAGCGTGCTGGCAGCAGCGCGCAAGGCAC GGGACAAGGGCAGCACGCGCTTCTGCATGGGGGCTGCGTGGCGCGACATGCGCGGACGCAAAAACAGCCTCAGCA ACATCACGGCCATGGTGCGCCAAGTACGGGCCATGGGCATGGAGGTTTGCGTGACGCTGGGCATGATTGACGGAG TGCAGGCGCGCCAGCTCAAGGAGGCGGGACTGACGGCCTACAACCACAATGTCGACACGAGCCGCGAGTTCTACC CCTCGGTCATCTCGACGCGCTCCTACGACGAGCGCCTCGCCACGCTGCGCCATGTCCGCGACGCTGGCCTCCGCG TCTGCTCGGGCGGCATCCTGGGACTGGGCGAGTCGTCCGAGGACCGCGTTGGCCTGCTCTACACCCTCGCCACTC TGCCCCAGCACCCCGAGAGCTTCCCCGTCAATGCCCTGGTGCCCATCAAGGGCACGCCGCTCGAGGATGCTGCCC CCGTGGCCTTTACCAGCATCCTACGCACCGTTGCCACGGCCCGCATCCTCATGCCCAGAACCATTATCCGCATTG CTGCCGGCCGCAACACCATGGCCGAGGAGAAGCAGGCCCTGTGCTTCATGGCCGGCGCCAATGCCGTCTTTACCG GCGAAAAGATGCTCACCACCGACTGCAACAGCTGGGACCAAGACAGCGCCATGTTTGGCCGCTGGGGGCTGACTG CCATGCGCAGCTTTGAGCAAGAAGACGGTGGCCAAGGCCAATAG |