Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6706
Gene name
LocationContig_63:93354..94227
Strand-
Gene length (bp)873
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 8.3E-18 56 133
PF01822 WSC WSC domain 1.2E-14 189 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 49 281 6.0E-28
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 54 281 5.0E-21
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 52 281 1.0E-18
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 53 288 1.0E-17
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 44 143 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 49 281 6.0E-28
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 54 281 5.0E-21
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 52 281 1.0E-18
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 53 288 1.0E-17
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 44 143 5.0E-15
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 38 142 4.0E-13
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 163 282 6.0E-11
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 163 282 8.0E-11
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 179 287 2.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 188 285 9.0E-09
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 188 281 2.0E-08
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 175 281 2.0E-08
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 187 289 1.0E-07
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 188 281 3.0E-07
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 43 175 7.0E-07
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 54 179 1.0E-06
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 191 283 1.0E-06
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 54 178 3.0E-06
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 42 141 7.0E-06
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 50 238 7.0E-06
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 54 144 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6706
MRAAWRLVALALVAGASSLASADSTMRGDEVVHFATRPKPWTGPATKDTVGPFSWQGCWTEATDGRALADDAMAS
DDMTLEACARFCNDFVFFGAEYGRECYCGNSLHEGSVRAKHQQDCSFLCAGDKSEYCGAGLRLQLYRQDTCTTSP
LPISVPTSPFSSQPPPTSSLSVPPTGPIVWPGNAEFAFYSCVSEPSKGRLLATQMVNDGNSMTVELCLQACSSYA
WAGVEYGRECWCGDSLNLAGSVGAIPARNVSQAECNIPCPGDGNVYCGAGLRISLYASREAAVAN*
Coding >OphauB2|6706
ATGAGAGCTGCCTGGCGTCTGGTGGCCCTGGCTCTCGTGGCCGGGGCAAGCAGCCTGGCCTCGGCGGATAGCACC
ATGCGGGGCGACGAGGTTGTCCATTTTGCCACGAGGCCCAAGCCTTGGACTGGCCCAGCAACCAAGGACACGGTT
GGCCCCTTTAGCTGGCAGGGCTGCTGGACCGAAGCAACAGACGGGCGTGCCTTGGCTGACGATGCCATGGCAAGC
GACGACATGACTCTCGAGGCTTGTGCACGATTCTGCAACGACTTTGTCTTTTTCGGAGCCGAGTATGGACGCGAA
TGCTACTGTGGCAACAGCCTGCACGAGGGAAGTGTCCGAGCCAAGCATCAGCAAGACTGCTCCTTTTTGTGTGCC
GGTGACAAGAGCGAATATTGCGGCGCCGGCCTCAGGCTGCAACTATACAGGCAGGACACCTGCACCACTAGCCCT
CTGCCAATCTCGGTGCCCACCAGCCCTTTCTCGAGCCAGCCGCCGCCCACGTCGTCCCTGTCTGTGCCGCCAACA
GGGCCCATCGTTTGGCCCGGCAACGCCGAATTTGCCTTTTACTCTTGCGTCTCGGAGCCCTCCAAGGGCCGTCTG
CTCGCTACCCAAATGGTCAACGACGGCAACAGCATGACGGTCGAGCTCTGTCTCCAAGCCTGCTCCAGCTATGCG
TGGGCTGGGGTGGAATACGGCCGCGAGTGCTGGTGTGGCGACAGCCTCAATCTGGCTGGCAGCGTGGGCGCTATA
CCCGCCAGAAACGTCTCGCAAGCAGAGTGCAACATACCGTGTCCTGGAGACGGCAACGTCTATTGCGGTGCCGGG
CTCAGAATCAGTCTATATGCCAGCAGGGAAGCCGCCGTGGCAAATTAA
Transcript >OphauB2|6706
ATGAGAGCTGCCTGGCGTCTGGTGGCCCTGGCTCTCGTGGCCGGGGCAAGCAGCCTGGCCTCGGCGGATAGCACC
ATGCGGGGCGACGAGGTTGTCCATTTTGCCACGAGGCCCAAGCCTTGGACTGGCCCAGCAACCAAGGACACGGTT
GGCCCCTTTAGCTGGCAGGGCTGCTGGACCGAAGCAACAGACGGGCGTGCCTTGGCTGACGATGCCATGGCAAGC
GACGACATGACTCTCGAGGCTTGTGCACGATTCTGCAACGACTTTGTCTTTTTCGGAGCCGAGTATGGACGCGAA
TGCTACTGTGGCAACAGCCTGCACGAGGGAAGTGTCCGAGCCAAGCATCAGCAAGACTGCTCCTTTTTGTGTGCC
GGTGACAAGAGCGAATATTGCGGCGCCGGCCTCAGGCTGCAACTATACAGGCAGGACACCTGCACCACTAGCCCT
CTGCCAATCTCGGTGCCCACCAGCCCTTTCTCGAGCCAGCCGCCGCCCACGTCGTCCCTGTCTGTGCCGCCAACA
GGGCCCATCGTTTGGCCCGGCAACGCCGAATTTGCCTTTTACTCTTGCGTCTCGGAGCCCTCCAAGGGCCGTCTG
CTCGCTACCCAAATGGTCAACGACGGCAACAGCATGACGGTCGAGCTCTGTCTCCAAGCCTGCTCCAGCTATGCG
TGGGCTGGGGTGGAATACGGCCGCGAGTGCTGGTGTGGCGACAGCCTCAATCTGGCTGGCAGCGTGGGCGCTATA
CCCGCCAGAAACGTCTCGCAAGCAGAGTGCAACATACCGTGTCCTGGAGACGGCAACGTCTATTGCGGTGCCGGG
CTCAGAATCAGTCTATATGCCAGCAGGGAAGCCGCCGTGGCAAATTAA
Gene >OphauB2|6706
ATGAGAGCTGCCTGGCGTCTGGTGGCCCTGGCTCTCGTGGCCGGGGCAAGCAGCCTGGCCTCGGCGGATAGCACC
ATGCGGGGCGACGAGGTTGTCCATTTTGCCACGAGGCCCAAGCCTTGGACTGGCCCAGCAACCAAGGACACGGTT
GGCCCCTTTAGCTGGCAGGGCTGCTGGACCGAAGCAACAGACGGGCGTGCCTTGGCTGACGATGCCATGGCAAGC
GACGACATGACTCTCGAGGCTTGTGCACGATTCTGCAACGACTTTGTCTTTTTCGGAGCCGAGTATGGACGCGAA
TGCTACTGTGGCAACAGCCTGCACGAGGGAAGTGTCCGAGCCAAGCATCAGCAAGACTGCTCCTTTTTGTGTGCC
GGTGACAAGAGCGAATATTGCGGCGCCGGCCTCAGGCTGCAACTATACAGGCAGGACACCTGCACCACTAGCCCT
CTGCCAATCTCGGTGCCCACCAGCCCTTTCTCGAGCCAGCCGCCGCCCACGTCGTCCCTGTCTGTGCCGCCAACA
GGGCCCATCGTTTGGCCCGGCAACGCCGAATTTGCCTTTTACTCTTGCGTCTCGGAGCCCTCCAAGGGCCGTCTG
CTCGCTACCCAAATGGTCAACGACGGCAACAGCATGACGGTCGAGCTCTGTCTCCAAGCCTGCTCCAGCTATGCG
TGGGCTGGGGTGGAATACGGCCGCGAGTGCTGGTGTGGCGACAGCCTCAATCTGGCTGGCAGCGTGGGCGCTATA
CCCGCCAGAAACGTCTCGCAAGCAGAGTGCAACATACCGTGTCCTGGAGACGGCAACGTCTATTGCGGTGCCGGG
CTCAGAATCAGTCTATATGCCAGCAGGGAAGCCGCCGTGGCAAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail