Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6705
Gene name
LocationContig_63:91160..92780
Strand-
Gene length (bp)1620
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07350 DUF1479 Protein of unknown function (DUF1479) 1.4E-157 48 469

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P75791|YBIU_ECOLI Uncharacterized protein YbiU OS=Escherichia coli (strain K12) GN=ybiU PE=1 SV=1 75 470 5.0E-46

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3480
Ophiocordyceps australis map64 (Brazil) OphauB2|6705 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02181
Ophiocordyceps camponoti-rufipedis Ophun1|1479
Ophiocordyceps kimflemingae Ophio5|2863
Ophiocordyceps kimflemingae Ophio5|2864
Ophiocordyceps subramaniannii Hirsu2|10134
Ophiocordyceps subramaniannii Hirsu2|559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6705
MFRLALRSRGSFAHPFCRAASTATTASPKKQGNISDSFWSFSGSERPSLPDRFRQLKLDLIQGYEEDLVESWATL
LQRLNKENAEVAEKECNVIPQIEFQHLGRDCQELKSEILKRGVVLVRGVIPEPEARAYKEQIEEYIRQNPHTKAF
PPNNPQVFELYWSEAQLKARSHPNLIKLQRHLLTSFWKTWSASTHISLNNPITYADRLRIRQPGDSSFALGPHVD
GGSVERWEKEGYGKGGVYDKIFQGKWNEYDAWDASGRVDAVNNLYDGLGACSMFRPWQGWLSISHSGPRQGTLLV
NPLMHMTTPYILLRPFFEPLRAGKGPDFLDKSNWRFTASSRMTSELQGATPGHGLELNDHEHPHLELKSTMVHIP
EIKPGDFVAWHCDTIHAVDKQHQGTSDSSVLYIPVCPVTTLNAEYLVRQRDAFRKGTPGPDFPGGEGESQHVGRP
TEEAFRQWTTAQGRQAFGLDRLEAVSKATAGERGAIERANSILGF*
Coding >OphauB2|6705
ATGTTTCGTCTGGCTCTTCGCTCTCGAGGCAGCTTCGCACACCCCTTTTGCAGAGCGGCGTCAACCGCCACCACA
GCTTCCCCCAAGAAGCAAGGCAACATCTCAGACTCATTCTGGTCTTTTTCTGGCTCAGAGAGACCGTCTTTGCCA
GATAGATTTCGTCAGCTCAAGTTGGACCTAATCCAAGGCTATGAAGAAGACCTTGTAGAGAGCTGGGCCACGTTG
TTGCAAAGACTCAACAAGGAAAACGCCGAGGTTGCTGAAAAAGAATGCAACGTGATTCCTCAGATTGAGTTTCAG
CATCTTGGGAGAGACTGCCAGGAACTCAAGTCTGAAATCTTAAAGAGGGGTGTCGTCCTTGTCCGAGGCGTTATC
CCCGAGCCAGAGGCCCGAGCCTACAAGGAACAAATTGAAGAATACATCAGGCAGAATCCGCACACAAAGGCTTTT
CCGCCAAACAATCCTCAAGTGTTTGAGCTCTATTGGTCCGAGGCTCAACTCAAAGCGCGCTCTCATCCAAACCTC
ATTAAGCTTCAACGCCATTTACTGACGTCTTTTTGGAAAACTTGGTCTGCTTCCACTCACATATCCCTCAACAAC
CCAATTACGTATGCCGATAGACTTCGAATCCGCCAGCCTGGTGATTCTTCCTTCGCTCTAGGTCCTCATGTCGAC
GGCGGTAGCGTCGAGCGCTGGGAAAAGGAAGGCTATGGCAAAGGCGGTGTCTACGATAAAATTTTCCAAGGGAAA
TGGAACGAATACGATGCTTGGGACGCCAGCGGCAGAGTTGACGCCGTCAACAACCTTTATGATGGGCTCGGAGCA
TGCTCCATGTTTCGACCTTGGCAAGGCTGGCTCAGCATCAGCCATTCTGGGCCGCGCCAAGGGACGCTTTTGGTA
AACCCGCTGATGCATATGACAACGCCTTATATCCTGCTCAGGCCTTTCTTTGAGCCTTTGAGGGCAGGTAAAGGC
CCGGACTTCCTCGATAAGAGCAACTGGCGCTTCACCGCGTCGTCGAGAATGACGAGTGAGCTCCAGGGGGCAACG
CCGGGCCATGGCCTGGAACTCAACGACCATGAGCATCCTCATCTCGAGCTCAAGAGTACAATGGTGCACATTCCC
GAGATCAAGCCGGGTGACTTTGTGGCATGGCACTGTGACACCATACACGCTGTCGACAAGCAGCATCAAGGCACC
AGTGACTCAAGCGTGCTCTACATACCAGTGTGCCCTGTGACGACTCTCAACGCGGAATACTTGGTGCGCCAACGC
GACGCGTTCCGGAAAGGGACGCCAGGGCCTGATTTTCCTGGTGGTGAGGGCGAGTCGCAGCACGTTGGGCGGCCG
ACGGAGGAAGCATTTCGGCAGTGGACGACAGCCCAGGGACGACAAGCATTTGGACTTGACAGGCTCGAAGCTGTG
TCCAAGGCCACGGCAGGCGAAAGAGGGGCGATTGAAAGGGCAAACTCGATTCTAGGTTTCTAA
Transcript >OphauB2|6705
ATGTTTCGTCTGGCTCTTCGCTCTCGAGGCAGCTTCGCACACCCCTTTTGCAGAGCGGCGTCAACCGCCACCACA
GCTTCCCCCAAGAAGCAAGGCAACATCTCAGACTCATTCTGGTCTTTTTCTGGCTCAGAGAGACCGTCTTTGCCA
GATAGATTTCGTCAGCTCAAGTTGGACCTAATCCAAGGCTATGAAGAAGACCTTGTAGAGAGCTGGGCCACGTTG
TTGCAAAGACTCAACAAGGAAAACGCCGAGGTTGCTGAAAAAGAATGCAACGTGATTCCTCAGATTGAGTTTCAG
CATCTTGGGAGAGACTGCCAGGAACTCAAGTCTGAAATCTTAAAGAGGGGTGTCGTCCTTGTCCGAGGCGTTATC
CCCGAGCCAGAGGCCCGAGCCTACAAGGAACAAATTGAAGAATACATCAGGCAGAATCCGCACACAAAGGCTTTT
CCGCCAAACAATCCTCAAGTGTTTGAGCTCTATTGGTCCGAGGCTCAACTCAAAGCGCGCTCTCATCCAAACCTC
ATTAAGCTTCAACGCCATTTACTGACGTCTTTTTGGAAAACTTGGTCTGCTTCCACTCACATATCCCTCAACAAC
CCAATTACGTATGCCGATAGACTTCGAATCCGCCAGCCTGGTGATTCTTCCTTCGCTCTAGGTCCTCATGTCGAC
GGCGGTAGCGTCGAGCGCTGGGAAAAGGAAGGCTATGGCAAAGGCGGTGTCTACGATAAAATTTTCCAAGGGAAA
TGGAACGAATACGATGCTTGGGACGCCAGCGGCAGAGTTGACGCCGTCAACAACCTTTATGATGGGCTCGGAGCA
TGCTCCATGTTTCGACCTTGGCAAGGCTGGCTCAGCATCAGCCATTCTGGGCCGCGCCAAGGGACGCTTTTGGTA
AACCCGCTGATGCATATGACAACGCCTTATATCCTGCTCAGGCCTTTCTTTGAGCCTTTGAGGGCAGGTAAAGGC
CCGGACTTCCTCGATAAGAGCAACTGGCGCTTCACCGCGTCGTCGAGAATGACGAGTGAGCTCCAGGGGGCAACG
CCGGGCCATGGCCTGGAACTCAACGACCATGAGCATCCTCATCTCGAGCTCAAGAGTACAATGGTGCACATTCCC
GAGATCAAGCCGGGTGACTTTGTGGCATGGCACTGTGACACCATACACGCTGTCGACAAGCAGCATCAAGGCACC
AGTGACTCAAGCGTGCTCTACATACCAGTGTGCCCTGTGACGACTCTCAACGCGGAATACTTGGTGCGCCAACGC
GACGCGTTCCGGAAAGGGACGCCAGGGCCTGATTTTCCTGGTGGTGAGGGCGAGTCGCAGCACGTTGGGCGGCCG
ACGGAGGAAGCATTTCGGCAGTGGACGACAGCCCAGGGACGACAAGCATTTGGACTTGACAGGCTCGAAGCTGTG
TCCAAGGCCACGGCAGGCGAAAGAGGGGCGATTGAAAGGGCAAACTCGATTCTAGGTTTCTAA
Gene >OphauB2|6705
ATGTTTCGTCTGGCTCTTCGCTCTCGAGGCAGCTTCGCACACCCCTTTTGCAGAGCGGCGTCAACCGCCACCACA
GCTTCCCCCAAGAAGCAAGGCAACATCTCAGACTCATTCTGGTCTTTTTCTGGCTCAGAGAGACCGTCTTTGCCA
GATAGATTTCGTCAGCTCAAGTTGGACCTAATCCAAGGCTATGAAGAAGACCTTGTAGAGAGCTGGGCCACGTTG
TTGCAAAGACTCAACAAGGAAAACGCCGAGGTTGCTGAAAAAGAATGCAACGTGATTCCTCAGATTGAGTTTCAG
CATCTTGGGAGAGACTGCCAGGAACTCAAGTCTGAAATCTTAAAGAGGGGTGTCGTCCTTGTCCGAGGCGTTATC
CCCGAGCCAGAGGCCCGAGCCTACAAGGAACAAATTGAAGAATACATCAGGCAGAATCCGCACACAAAGGGTCAG
TTGAGTTTGGCCCCAGTATGTTGACAGGGAGAGAGATTCTGATGAAGCAGCTGATTTGCCCGCATGCAGCTTTTC
CGCCAAACAATCCTCAAGTGTTTGAGCTCTATTGGTCCGAGGCTCAACTCAAAGCGCGCTCTCATCCAAACCTCA
TTAAGCTTCAACGCCATTTACTGACGTCTTTTTGGAAAACTTGGTCTGCTTCCACTCACATATCCCTCAACAACC
CAATTACGTATGCCGATAGACTTCGAATCCGCCAGCCTGGTGATTCTTCCTTCGCTCTAGGTCCTCATGTCGACG
GCGGTAGCGTCGAGCGCTGGGAAAAGGAAGGCTATGGCAAAGGCGGTGTCTACGATAAAATTTTCCAAGGGAAAT
GGAACGAATACGATGCTTGGGACGCCAGCGGCAGAGTTGACGCCGTCAACAACCTTTATGATGGGCTCGGAGCAT
GCTCCATGTTTCGACCTTGGCAAGGCTGGCTCAGCATCAGCCATTCTGGGCCGCGCCAAGGGACGCTTTTGGTAA
ACCCGCTGATGCATATGACAACGCCTTATATCCTGCTCAGGCCTTTCTTTGAGCCTTTGAGGGCAGGTAAAGGCC
CGGACTTCCTCGATAAGAGCAACTGGCGCTTCACCGCGTCGTCGAGAATGACGAGTGAGCTCCAGGGGGCAACGC
CGGGCCATGGCCTGGAACTCAACGACCATGAGCATCCTCATCTCGAGCTCAAGAGTACAATGGTGCACATTCCCG
AGATCAAGCCGGGTGACTTTGTGGCATGGCACTGTGACAGTAGGCCAAACGACGGCCGCGTGTTGCCATGGAAGA
AGCATTGCTGACGATGCTATAGCCATACACGCTGTCGACAAGCAGCATCAAGGCACCAGTGACTCAAGCGTGCTC
TACATACCAGTGTGCCCTGTGACGACTCTCAACGCGGAATACTTGGTGCGCCAACGCGACGCGTTCCGGAAAGGG
ACGCCAGGGCCTGATTTTCCTGGTGGTGAGGGCGAGTCGCAGCACGTTGGGCGGCCGACGGAGGAAGCATTTCGG
CAGTGGACGACAGCCCAGGGACGACAAGCATTTGGACTTGACAGGCTCGAAGCTGTGTCCAAGGCCACGGCAGGC
GAAAGAGGGGCGATTGAAAGGGCAAACTCGATTCTAGGTTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail