Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6686
Gene name
LocationContig_63:43955..44742
Strand-
Gene length (bp)787
Transcript length (bp)720
Coding sequence length (bp)720
Protein length (aa) 240

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11712 Vma12 Endoplasmic reticulum-based factor for assembly of V-ATPase 1.4E-40 74 216

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0043933 protein-containing complex organization No
GO:0065003 protein-containing complex assembly No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 156 178 22
2 188 210 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6686
MVLLTMTRPVVDVLSSLDTCSLDTCPSHGSSADEPPLHEPAIGKPISHAQLLALWRKLQSSPPMSASSPYCLEQL
LSGSSVFLPPPPPKPEPSAEYKALMARLRREEAARTYERMMKQPLEARLPAAAQSFAAANRPTSSTDLGDDDVTY
AEVHRHLVLILNFIASIVGVAATLWIAARWWSLPARFFLTLGGSILVAVAEVIVYQGYIWRLSQAKSKQQSVQEV
KKVVSTWVVGKTDD*
Coding >OphauB2|6686
ATGGTGCTCCTCACCATGACGCGGCCCGTCGTCGACGTCTTGTCCAGTCTCGACACCTGCAGTCTCGACACTTGT
CCCTCGCACGGCTCCTCGGCCGACGAACCGCCGCTGCACGAGCCCGCCATTGGAAAGCCCATTTCTCACGCCCAG
CTTCTGGCCCTGTGGCGGAAGCTGCAGTCGTCACCGCCAATGTCAGCTTCATCCCCGTATTGCCTGGAACAGCTC
TTGAGTGGCTCAAGCGTCTTCTTGCCGCCGCCGCCGCCCAAGCCGGAGCCCTCTGCCGAGTACAAGGCCCTCATG
GCTCGACTCCGCCGCGAGGAGGCCGCTCGCACTTACGAGCGCATGATGAAGCAGCCTTTGGAAGCTCGCCTCCCG
GCTGCTGCGCAGTCATTCGCCGCCGCCAATCGTCCCACAAGCTCAACAGACCTCGGCGATGACGACGTTACGTAC
GCCGAAGTCCATCGTCATCTGGTGCTCATTCTAAACTTTATAGCCAGTATAGTGGGCGTTGCGGCGACACTTTGG
ATCGCGGCACGGTGGTGGAGCCTACCCGCACGTTTCTTTCTTACCCTTGGCGGCAGCATTCTAGTGGCTGTTGCT
GAAGTAATAGTCTACCAAGGTTACATCTGGAGATTGAGCCAAGCCAAGTCGAAGCAACAGTCAGTTCAGGAAGTC
AAAAAGGTGGTTAGCACCTGGGTTGTAGGCAAGACTGATGACTGA
Transcript >OphauB2|6686
ATGGTGCTCCTCACCATGACGCGGCCCGTCGTCGACGTCTTGTCCAGTCTCGACACCTGCAGTCTCGACACTTGT
CCCTCGCACGGCTCCTCGGCCGACGAACCGCCGCTGCACGAGCCCGCCATTGGAAAGCCCATTTCTCACGCCCAG
CTTCTGGCCCTGTGGCGGAAGCTGCAGTCGTCACCGCCAATGTCAGCTTCATCCCCGTATTGCCTGGAACAGCTC
TTGAGTGGCTCAAGCGTCTTCTTGCCGCCGCCGCCGCCCAAGCCGGAGCCCTCTGCCGAGTACAAGGCCCTCATG
GCTCGACTCCGCCGCGAGGAGGCCGCTCGCACTTACGAGCGCATGATGAAGCAGCCTTTGGAAGCTCGCCTCCCG
GCTGCTGCGCAGTCATTCGCCGCCGCCAATCGTCCCACAAGCTCAACAGACCTCGGCGATGACGACGTTACGTAC
GCCGAAGTCCATCGTCATCTGGTGCTCATTCTAAACTTTATAGCCAGTATAGTGGGCGTTGCGGCGACACTTTGG
ATCGCGGCACGGTGGTGGAGCCTACCCGCACGTTTCTTTCTTACCCTTGGCGGCAGCATTCTAGTGGCTGTTGCT
GAAGTAATAGTCTACCAAGGTTACATCTGGAGATTGAGCCAAGCCAAGTCGAAGCAACAGTCAGTTCAGGAAGTC
AAAAAGGTGGTTAGCACCTGGGTTGTAGGCAAGACTGATGACTGA
Gene >OphauB2|6686
ATGGTGCTCCTCACCATGACGCGGCCCGTCGTCGACGTCTTGTCCAGTCTCGACACCTGCAGTCTCGACACTTGT
CCCTCGCACGGCTCCTCGGCCGACGAACCGCCGCTGCACGAGCCCGCCATTGGAAAGCCCATTTCTCACGCCCAG
CTTCTGGCCCTGTGGCGGAAGCTGCAGTCGTCACCGCCAATGTCAGCTTCATCCCCGTATTGCCTGGAACAGCTC
TTGAGTGGCTCAAGCGTCTTCTTGCCGCCGCCGCCGCCCAAGCCGGAGCCCGTTGGTGCCCTTGGGTCGCCTGAC
CCTCGACTGCCAACTGCGAGTTGGTTGCTGACTCGTCTTGTAGTCTGCCGAGTACAAGGCCCTCATGGCTCGACT
CCGCCGCGAGGAGGCCGCTCGCACTTACGAGCGCATGATGAAGCAGCCTTTGGAAGCTCGCCTCCCGGCTGCTGC
GCAGTCATTCGCCGCCGCCAATCGTCCCACAAGCTCAACAGACCTCGGCGATGACGACGTTACGTACGCCGAAGT
CCATCGTCATCTGGTGCTCATTCTAAACTTTATAGCCAGTATAGTGGGCGTTGCGGCGACACTTTGGATCGCGGC
ACGGTGGTGGAGCCTACCCGCACGTTTCTTTCTTACCCTTGGCGGCAGCATTCTAGTGGCTGTTGCTGAAGTAAT
AGTCTACCAAGGTTACATCTGGAGATTGAGCCAAGCCAAGTCGAAGCAACAGTCAGTTCAGGAAGTCAAAAAGGT
GGTTAGCACCTGGGTTGTAGGCAAGACTGATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail