Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6681
Gene name
LocationContig_63:34123..34963
Strand+
Gene length (bp)840
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.8E-10 41 119
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.9E-07 122 191
PF13606 Ank_3 Ankyrin repeat 4.1E-04 88 115
PF00023 Ank Ankyrin repeat 3.9E-04 90 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04749|AVO2_YEAST Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVO2 PE=1 SV=1 15 213 3.0E-14
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 31 226 4.0E-12
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 88 245 2.0E-10
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 88 203 4.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 88 203 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04749|AVO2_YEAST Target of rapamycin complex 2 subunit AVO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVO2 PE=1 SV=1 15 213 3.0E-14
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 31 226 4.0E-12
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 88 245 2.0E-10
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 88 203 4.0E-10
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 88 203 9.0E-10
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 88 245 1.0E-09
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 56 186 4.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 58 202 1.0E-08
sp|Q9HFE7|YNW5_SCHPO Ankyrin repeat-containing protein P16F5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP16F5.05c PE=3 SV=1 93 232 2.0E-08
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 58 197 2.0E-08
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 56 186 3.0E-08
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 56 186 4.0E-08
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 58 197 6.0E-08
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 58 202 9.0E-08
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 53 228 1.0E-07
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 58 186 3.0E-07
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 95 203 4.0E-07
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 55 202 4.0E-07
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 53 228 4.0E-07
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 31 168 5.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 58 186 6.0E-07
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 54 188 6.0E-07
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 84 203 7.0E-07
sp|Q3U0L2|AN33B_MOUSE Ankyrin repeat domain-containing protein 33B OS=Mus musculus GN=Ankrd33b PE=1 SV=1 86 191 7.0E-07
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 25 202 8.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 58 198 9.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 47 232 1.0E-06
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 87 197 1.0E-06
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 91 214 1.0E-06
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 91 214 1.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 25 202 1.0E-06
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 91 214 1.0E-06
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 87 197 2.0E-06
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 58 202 2.0E-06
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 91 191 2.0E-06
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 58 202 2.0E-06
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 53 217 2.0E-06
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 25 202 2.0E-06
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 58 226 2.0E-06
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 58 219 2.0E-06
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 57 210 2.0E-06
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 83 220 2.0E-06
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 87 197 3.0E-06
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 87 197 3.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 58 186 3.0E-06
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 53 185 3.0E-06
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 55 244 5.0E-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 87 197 5.0E-06
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 47 210 6.0E-06
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 43 197 6.0E-06
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 19 178 6.0E-06
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 7 202 6.0E-06
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 33 174 6.0E-06
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 52 185 8.0E-06
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 47 210 8.0E-06
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 41 197 9.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 58 191 9.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 23 203 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6681
MPFEAAVPSSIAMIEPSIRLRRAIHAADASLVERILKSHPWLLHNPDASNTGLSNSNLHLAASLGFKDICETLLR
AGHDRPCPALNENHETALMLAARAGHTDVVHLLCEHDRASILRRDVRGRDAIMEASIAGHDTILQLLLTYVPGGP
YEAVQMVDMEGNTALHFASSSGNLLGLRTLMAAGADPERRNYWNWTPYAYSASVQTEVYFKSLVTGAERLQQIKK
ETGMLRKGGAVRVVMDDGHD*
Coding >OphauB2|6681
ATGCCTTTTGAGGCGGCTGTGCCGTCGTCCATCGCAATGATCGAGCCTTCAATCCGCCTGCGACGGGCGATTCAC
GCTGCAGACGCCTCGCTGGTGGAGCGGATTCTCAAATCACATCCTTGGCTGCTACACAACCCCGATGCCTCCAAC
ACGGGTCTTTCCAACTCGAATCTGCATCTCGCCGCCTCTCTAGGCTTCAAGGACATCTGCGAAACGCTTTTACGC
GCGGGCCACGACAGGCCATGTCCAGCCCTCAACGAGAACCACGAGACAGCGCTCATGCTGGCGGCTCGTGCTGGC
CACACCGATGTGGTCCATTTGCTGTGTGAGCATGACAGGGCCAGCATCTTGCGGCGCGATGTGCGAGGCCGCGAC
GCCATCATGGAGGCCAGCATTGCAGGCCACGACACCATTCTTCAGCTGCTGCTCACCTACGTCCCCGGAGGCCCC
TACGAGGCTGTACAAATGGTGGACATGGAAGGAAACACGGCCCTGCATTTTGCAAGTAGCAGCGGCAATCTGCTT
GGCCTGCGCACACTCATGGCTGCCGGAGCAGACCCCGAAAGGCGCAACTACTGGAACTGGACACCCTACGCCTAC
AGCGCCTCGGTTCAGACCGAAGTCTACTTCAAAAGCCTCGTGACGGGGGCTGAGAGGCTGCAGCAGATCAAAAAG
GAGACTGGCATGCTGAGAAAGGGCGGTGCTGTCCGCGTCGTCATGGATGACGGCCACGATTAG
Transcript >OphauB2|6681
ATGCCTTTTGAGGCGGCTGTGCCGTCGTCCATCGCAATGATCGAGCCTTCAATCCGCCTGCGACGGGCGATTCAC
GCTGCAGACGCCTCGCTGGTGGAGCGGATTCTCAAATCACATCCTTGGCTGCTACACAACCCCGATGCCTCCAAC
ACGGGTCTTTCCAACTCGAATCTGCATCTCGCCGCCTCTCTAGGCTTCAAGGACATCTGCGAAACGCTTTTACGC
GCGGGCCACGACAGGCCATGTCCAGCCCTCAACGAGAACCACGAGACAGCGCTCATGCTGGCGGCTCGTGCTGGC
CACACCGATGTGGTCCATTTGCTGTGTGAGCATGACAGGGCCAGCATCTTGCGGCGCGATGTGCGAGGCCGCGAC
GCCATCATGGAGGCCAGCATTGCAGGCCACGACACCATTCTTCAGCTGCTGCTCACCTACGTCCCCGGAGGCCCC
TACGAGGCTGTACAAATGGTGGACATGGAAGGAAACACGGCCCTGCATTTTGCAAGTAGCAGCGGCAATCTGCTT
GGCCTGCGCACACTCATGGCTGCCGGAGCAGACCCCGAAAGGCGCAACTACTGGAACTGGACACCCTACGCCTAC
AGCGCCTCGGTTCAGACCGAAGTCTACTTCAAAAGCCTCGTGACGGGGGCTGAGAGGCTGCAGCAGATCAAAAAG
GAGACTGGCATGCTGAGAAAGGGCGGTGCTGTCCGCGTCGTCATGGATGACGGCCACGATTAG
Gene >OphauB2|6681
ATGCCTTTTGAGGCGGCTGTGTATGTGCTTTGTCGAGTTGGCTGCAACGCGGAAGTAGGCCGTCGTCCATCGCAA
TGCAAGTTCCAAGCCCTTGCTGCCCGGCGGCTACGACAAGCACTGACCAGATTTGTCGCCCTCAGGATCGAGCCT
TCAATCCGCCTGCGACGGGCGATTCACGCTGCAGACGCCTCGCTGGTGGAGCGGATTCTCAAATCACATCCTTGG
CTGCTACACAACCCCGATGCCTCCAACACGGGTCTTTCCAACTCGAATCTGCATCTCGCCGCCTCTCTAGGCTTC
AAGGACATCTGCGAAACGCTTTTACGCGCGGGCCACGACAGGCCATGTCCAGCCCTCAACGAGAACCACGAGACA
GCGCTCATGCTGGCGGCTCGTGCTGGCCACACCGATGTGGTCCATTTGCTGTGTGAGCATGACAGGGCCAGCATC
TTGCGGCGCGATGTGCGAGGCCGCGACGCCATCATGGAGGCCAGCATTGCAGGCCACGACACCATTCTTCAGCTG
CTGCTCACCTACGTCCCCGGAGGCCCCTACGAGGCTGTACAAATGGTGGACATGGAAGGAAACACGGCCCTGCAT
TTTGCAAGTAGCAGCGGCAATCTGCTTGGCCTGCGCACACTCATGGCTGCCGGAGCAGACCCCGAAAGGCGCAAC
TACTGGAACTGGACACCCTACGCCTACAGCGCCTCGGTTCAGACCGAAGTCTACTTCAAAAGCCTCGTGACGGGG
GCTGAGAGGCTGCAGCAGATCAAAAAGGAGACTGGCATGCTGAGAAAGGGCGGTGCTGTCCGCGTCGTCATGGAT
GACGGCCACGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail