Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6675
Gene name
LocationContig_63:17619..18078
Strand+
Gene length (bp)459
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 7.2E-12 7 86

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 8 87 2.0E-11
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 8 152 2.0E-08
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 8 100 9.0E-08
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 8 83 2.0E-07
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 8 107 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 8 87 2.0E-11
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 8 152 2.0E-08
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 8 100 9.0E-08
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 8 83 2.0E-07
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 8 107 4.0E-07
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 8 86 4.0E-06
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 8 83 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 50 72 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6675
MFNIIPVWLYGSEIWPQEIRAKGYSFTVFGWATGCGMTQFLIPILLAKLGYGTYILFGAINIMSIPVIWLLYPET
ANRSLEDVSLLFTADSLLVKDNMAEYERRISQAGGNVAVAARRLLQEVDGDQGTDSPTRHDMSVGKDQAVVEETL
HQ*
Coding >OphauB2|6675
ATGTTCAACATTATTCCAGTCTGGCTCTATGGCTCGGAAATCTGGCCTCAAGAGATCCGCGCCAAGGGATACAGC
TTCACCGTCTTTGGCTGGGCAACTGGCTGTGGCATGACGCAGTTTCTCATACCCATCCTGCTCGCCAAGCTGGGC
TACGGCACCTACATCTTGTTTGGTGCCATCAACATCATGTCTATACCCGTCATCTGGCTGCTCTATCCCGAGACG
GCAAATCGCTCGCTCGAAGACGTCTCACTCCTCTTCACTGCTGACAGCCTGCTTGTCAAGGACAACATGGCCGAG
TATGAGCGTCGTATTTCGCAGGCCGGCGGAAACGTGGCGGTTGCTGCTCGTCGTCTGCTTCAGGAAGTCGATGGG
GATCAAGGTACAGATAGCCCCACTCGACACGACATGAGCGTTGGCAAGGATCAGGCAGTCGTTGAGGAAACGTTG
CACCAATAG
Transcript >OphauB2|6675
ATGTTCAACATTATTCCAGTCTGGCTCTATGGCTCGGAAATCTGGCCTCAAGAGATCCGCGCCAAGGGATACAGC
TTCACCGTCTTTGGCTGGGCAACTGGCTGTGGCATGACGCAGTTTCTCATACCCATCCTGCTCGCCAAGCTGGGC
TACGGCACCTACATCTTGTTTGGTGCCATCAACATCATGTCTATACCCGTCATCTGGCTGCTCTATCCCGAGACG
GCAAATCGCTCGCTCGAAGACGTCTCACTCCTCTTCACTGCTGACAGCCTGCTTGTCAAGGACAACATGGCCGAG
TATGAGCGTCGTATTTCGCAGGCCGGCGGAAACGTGGCGGTTGCTGCTCGTCGTCTGCTTCAGGAAGTCGATGGG
GATCAAGGTACAGATAGCCCCACTCGACACGACATGAGCGTTGGCAAGGATCAGGCAGTCGTTGAGGAAACGTTG
CACCAATAG
Gene >OphauB2|6675
ATGTTCAACATTATTCCAGTCTGGCTCTATGGCTCGGAAATCTGGCCTCAAGAGATCCGCGCCAAGGGATACAGC
TTCACCGTCTTTGGCTGGGCAACTGGCTGTGGCATGACGCAGTTTCTCATACCCATCCTGCTCGCCAAGCTGGGC
TACGGCACCTACATCTTGTTTGGTGCCATCAACATCATGTCTATACCCGTCATCTGGCTGCTCTATCCCGAGACG
GCAAATCGCTCGCTCGAAGACGTCTCACTCCTCTTCACTGCTGACAGCCTGCTTGTCAAGGACAACATGGCCGAG
TATGAGCGTCGTATTTCGCAGGCCGGCGGAAACGTGGCGGTTGCTGCTCGTCGTCTGCTTCAGGAAGTCGATGGG
GATCAAGGTACAGATAGCCCCACTCGACACGACATGAGCGTTGGCAAGGATCAGGCAGTCGTTGAGGAAACGTTG
CACCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail