Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6665
Gene name
LocationContig_63:753..1803
Strand-
Gene length (bp)1050
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 4.1E-34 29 328

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80402|DBD23_ASPOR 2,3-dihydroxybenzoate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000447 PE=1 SV=2 1 330 0.0E+00
sp|P0CT50|SDC_TRIMF Salicylate decarboxylase OS=Trichosporon moniliiforme GN=sdc PE=1 SV=1 1 328 1.0E-119
sp|P80346|DBD23_ASPNG 2,3-dihydroxybenzoate decarboxylase (Fragments) OS=Aspergillus niger PE=1 SV=1 1 212 1.0E-36
sp|Q0II68|ACMSD_BOVIN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Bos taurus GN=ACMSD PE=2 SV=1 44 332 2.0E-18
sp|Q54LN9|ACMSD_DICDI 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Dictyostelium discoideum GN=acmsd PE=3 SV=1 43 294 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80402|DBD23_ASPOR 2,3-dihydroxybenzoate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005000447 PE=1 SV=2 1 330 0.0E+00
sp|P0CT50|SDC_TRIMF Salicylate decarboxylase OS=Trichosporon moniliiforme GN=sdc PE=1 SV=1 1 328 1.0E-119
sp|P80346|DBD23_ASPNG 2,3-dihydroxybenzoate decarboxylase (Fragments) OS=Aspergillus niger PE=1 SV=1 1 212 1.0E-36
sp|Q0II68|ACMSD_BOVIN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Bos taurus GN=ACMSD PE=2 SV=1 44 332 2.0E-18
sp|Q54LN9|ACMSD_DICDI 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Dictyostelium discoideum GN=acmsd PE=3 SV=1 43 294 3.0E-17
sp|Q8R519|ACMSD_MOUSE 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Mus musculus GN=Acmsd PE=1 SV=2 44 294 7.0E-16
sp|Q8R5M5|ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus GN=Acmsd PE=1 SV=1 44 294 9.0E-16
sp|Q8TDX5|ACMSD_HUMAN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Homo sapiens GN=ACMSD PE=1 SV=1 43 294 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup829
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6202
Ophiocordyceps australis map64 (Brazil) OphauB2|6665 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05280
Ophiocordyceps camponoti-rufipedis Ophun1|7454
Ophiocordyceps kimflemingae Ophio5|7475
Ophiocordyceps subramaniannii Hirsu2|4064
Ophiocordyceps subramaniannii Hirsu2|4692

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6665
MKGKIALEEAFALPRFHDKTLWWASMFAVDAERHAAEIKDITNTRLKYMDEHGVGYTILSYTAPGVQDEWDAQVA
QRLAVEVNDYIADQISGHGDRFGAFATLSMHKPQEAAEELRRCVTKYGFKGALVNDTQRAGHDGDDMIFYDGPEW
DVFWATVTQLDVPFYLHPRNPTGTIHDKLWAKRKWLIGPPLSFAHGVSLHALGMITNGVFDRHPSLQLILGHLGE
HIPFDMWRINHWFEHVKKPLGLACQKTIRQYFEDNIWITTSGHFSTTTLQFCMAEIGPHRILFSIDYPFESFQDA
CHWYDGVELKPDDKLAIGRQNAERLFKLKAGTR*
Coding >OphauB2|6665
ATGAAGGGCAAGATTGCGCTTGAAGAGGCCTTTGCGCTGCCTCGATTCCACGACAAGACACTATGGTGGGCGTCC
ATGTTTGCAGTCGACGCAGAGCGCCACGCGGCTGAAATCAAAGACATTACCAACACGCGGCTCAAGTACATGGAC
GAGCATGGCGTGGGATACACGATTCTATCCTACACGGCGCCCGGGGTGCAGGATGAATGGGACGCCCAAGTGGCG
CAGCGCCTGGCCGTCGAGGTCAACGACTACATTGCGGACCAGATATCTGGCCACGGCGACCGCTTTGGAGCATTT
GCAACGCTGTCCATGCACAAGCCGCAAGAGGCTGCCGAGGAGCTGAGGCGCTGCGTGACCAAGTATGGCTTCAAG
GGCGCCCTCGTCAACGACACGCAGCGGGCGGGCCATGACGGCGACGACATGATCTTCTACGACGGCCCCGAATGG
GACGTCTTTTGGGCCACGGTGACGCAACTCGACGTGCCCTTTTATCTGCATCCGCGCAACCCCACAGGCACCATC
CATGACAAGCTCTGGGCCAAGAGGAAGTGGCTCATTGGGCCGCCGCTGTCCTTTGCCCATGGCGTCAGCCTACAC
GCGCTGGGCATGATTACCAACGGCGTCTTTGATCGGCATCCCAGCCTGCAGCTGATTCTCGGGCACTTGGGCGAG
CACATTCCCTTTGACATGTGGCGCATCAACCACTGGTTCGAGCATGTCAAGAAGCCGCTTGGCCTGGCCTGCCAA
AAGACCATTCGCCAGTATTTCGAGGACAATATCTGGATCACCACGAGCGGCCACTTTTCCACCACGACGCTGCAG
TTTTGCATGGCTGAGATTGGCCCCCACCGCATCTTGTTCTCCATAGACTATCCCTTTGAGTCGTTTCAGGATGCC
TGCCACTGGTACGATGGTGTTGAGCTAAAGCCCGACGACAAGCTTGCCATTGGCAGGCAAAACGCCGAGCGGCTG
TTTAAGCTCAAGGCCGGCACACGCTGA
Transcript >OphauB2|6665
ATGAAGGGCAAGATTGCGCTTGAAGAGGCCTTTGCGCTGCCTCGATTCCACGACAAGACACTATGGTGGGCGTCC
ATGTTTGCAGTCGACGCAGAGCGCCACGCGGCTGAAATCAAAGACATTACCAACACGCGGCTCAAGTACATGGAC
GAGCATGGCGTGGGATACACGATTCTATCCTACACGGCGCCCGGGGTGCAGGATGAATGGGACGCCCAAGTGGCG
CAGCGCCTGGCCGTCGAGGTCAACGACTACATTGCGGACCAGATATCTGGCCACGGCGACCGCTTTGGAGCATTT
GCAACGCTGTCCATGCACAAGCCGCAAGAGGCTGCCGAGGAGCTGAGGCGCTGCGTGACCAAGTATGGCTTCAAG
GGCGCCCTCGTCAACGACACGCAGCGGGCGGGCCATGACGGCGACGACATGATCTTCTACGACGGCCCCGAATGG
GACGTCTTTTGGGCCACGGTGACGCAACTCGACGTGCCCTTTTATCTGCATCCGCGCAACCCCACAGGCACCATC
CATGACAAGCTCTGGGCCAAGAGGAAGTGGCTCATTGGGCCGCCGCTGTCCTTTGCCCATGGCGTCAGCCTACAC
GCGCTGGGCATGATTACCAACGGCGTCTTTGATCGGCATCCCAGCCTGCAGCTGATTCTCGGGCACTTGGGCGAG
CACATTCCCTTTGACATGTGGCGCATCAACCACTGGTTCGAGCATGTCAAGAAGCCGCTTGGCCTGGCCTGCCAA
AAGACCATTCGCCAGTATTTCGAGGACAATATCTGGATCACCACGAGCGGCCACTTTTCCACCACGACGCTGCAG
TTTTGCATGGCTGAGATTGGCCCCCACCGCATCTTGTTCTCCATAGACTATCCCTTTGAGTCGTTTCAGGATGCC
TGCCACTGGTACGATGGTGTTGAGCTAAAGCCCGACGACAAGCTTGCCATTGGCAGGCAAAACGCCGAGCGGCTG
TTTAAGCTCAAGGCCGGCACACGCTGA
Gene >OphauB2|6665
ATGAAGGGCAAGATTGCGCTTGAAGAGGCCTTTGCGCTGCCTCGATTCCACGACAAGACACTATGGTGGGCGTCC
ATGTTTGCAGTCGACGCAGAGCGCCACGCGGCTGAAATCAAAGACATTACCAACACGCGGCTCAAGTACATGGAC
GAGCATGGCGTGGGATACACGATTCTATCCTACACGGCGCCCGGGGTGCAGGATGAATGGGACGCCCAAGTGGCG
CAGCGCCTGGCCGTCGAGGTCAACGACTACATTGCGGACCAGATATCTGGCCACGGCGACCGCTTTGGAGCATTT
GCGTCAGTTGGTCTGGTGGGCAGGCGAGAGGCGTGCTAACGTCTGGCCAGAACGCTGTCCATGCACAAGCCGCAA
GAGGCTGCCGAGGAGCTGAGGCGCTGCGTGACCAAGTATGGCTTCAAGGGCGCCCTCGTCAACGACACGCAGCGG
GCGGGCCATGACGGCGACGACATGATCTTCTACGACGGCCCCGAATGGGACGTCTTTTGGGCCACGGTGACGCAA
CTCGACGTGCCCTTTTATCTGCATCCGCGCAACCCCACAGGCACCATCCATGACAAGCTCTGGGCCAAGAGGAAG
TGGCTCATTGGGCCGCCGCTGTCCTTTGCCCATGGCGTCAGCCTACACGCGCTGGGCATGATTACCAACGGCGTC
TTTGATCGGCATCCCAGCCTGCAGCTGATTCTCGGGCACTTGGGCGAGCACATTCCCTTTGACATGTGGCGCATC
AACCACTGGTTCGAGCATGTCAAGAAGCCGCTTGGCCTGGCCTGCCAAAAGACCATTCGCCAGTATTTCGAGGAC
AATATCTGGATCACCACGAGCGGCCACTTTTCCACCACGACGCTGCAGTTTTGCATGGCTGAGATTGGCCCCCAC
CGCATCTTGTTCTCCATAGACTATCCCTTTGAGTCGTTTCAGGATGCCTGCCACTGGTACGATGGTGTTGAGCTA
AAGCCCGACGACAAGCTTGCCATTGGCAGGCAAAACGCCGAGCGGCTGTTTAAGCTCAAGGCCGGCACACGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail