Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6662
Gene name
LocationContig_62:102635..104989
Strand-
Gene length (bp)2354
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 3.8E-17 149 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74388|YNVD_SCHPO Uncharacterized protein C3H7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.13 PE=1 SV=1 128 246 1.0E-25
sp|Q28623|SLMAP_RABIT Sarcolemmal membrane-associated protein OS=Oryctolagus cuniculus GN=SLMAP PE=1 SV=2 148 246 1.0E-13
sp|Q14BN4|SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens GN=SLMAP PE=1 SV=1 148 246 1.0E-13
sp|P0C219|SLMAP_RAT Sarcolemmal membrane-associated protein OS=Rattus norvegicus GN=Slmap PE=1 SV=1 148 246 1.0E-13
sp|Q03944|VPS64_YEAST Vacuolar protein sorting-associated protein 64 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS64 PE=1 SV=1 164 260 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74388|YNVD_SCHPO Uncharacterized protein C3H7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.13 PE=1 SV=1 128 246 1.0E-25
sp|Q28623|SLMAP_RABIT Sarcolemmal membrane-associated protein OS=Oryctolagus cuniculus GN=SLMAP PE=1 SV=2 148 246 1.0E-13
sp|Q14BN4|SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens GN=SLMAP PE=1 SV=1 148 246 1.0E-13
sp|P0C219|SLMAP_RAT Sarcolemmal membrane-associated protein OS=Rattus norvegicus GN=Slmap PE=1 SV=1 148 246 1.0E-13
sp|Q03944|VPS64_YEAST Vacuolar protein sorting-associated protein 64 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS64 PE=1 SV=1 164 260 4.0E-13
sp|Q3URD3|SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus GN=Slmap PE=1 SV=2 148 246 8.0E-13
sp|Q06001|FAR10_YEAST Factor arrest protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAR10 PE=1 SV=1 164 247 8.0E-12
sp|Q10322|DMA1_SCHPO Probable E3 ubiquitin-protein ligase dma1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dma1 PE=1 SV=1 148 247 2.0E-10
sp|A6ZRW7|DMA2_YEAS7 E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DMA2 PE=3 SV=1 167 247 4.0E-07
sp|P53924|DMA2_YEAST E3 ubiquitin-protein ligase DMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA2 PE=1 SV=1 167 247 4.0E-07
sp|P46017|FRAH_NOSS1 Protein FraH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fraH PE=3 SV=1 143 226 4.0E-07
sp|P38823|DMA1_YEAST E3 ubiquitin-protein ligase DMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DMA1 PE=1 SV=1 167 247 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 688 710 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6662
MTAVASPPAFPQISRAAWGIGSDNQSTSPETTRGMFGTRKPLSRTNSSSSISSNSSNSTVTSNGSHINGTAASAS
ELGQWSDLSRIPAGRVNGLGTSPHLAAMQSASGPPQMAPQQQQQQQQYPQQQPFMRAMPSEQFSPSQPMLYTLRI
GRQTNQKTVPTTVNGFFDSKVLSRQHAEIFAERNGKVYIRDIKSSNGTFVNGTRLSQENRESEPHELQTSDQLEL
GIDIVSEDQKTVIHHKVAARVEHAGFASNTNNVLDMSFGDLDPANGSMLVPNGSLQMRGRTGSNASTLSGGRMTP
SAGATGGVGVAGASQQRPFFVSPVATDQIIKRLANEIRNARLQAQDLNRTHQFVKTLLSKEDIKDLERPEPRPEP
RPEPSRPPVHPVTNGSSMRADARTRFSDPPAPPPQQPLPEKPDVPSLRRGASDRPRASGMSPRQENLSQIIQLTE
ALNNAKRDIDSQTTRMQELEIMLQREREAREVAEDVARRLEAAASVLHVKDVGQPDDLEEHASLNIQSTAQSEER
GALTDQEHASMMDPTDAARETVVALQSRVENMESQMMDLRQHVEMWKRRSETAESERDESRQTLAEMVLKLRVEE
SRRATAEAKSRSRSRHARSRQRAPGPDDETSSASHVDGPAATPFSKQLPVDGPLQDDPGDCDEQTSQTNPPSSTD
DSQNVQTHMHAALPYASMIGVVLVGMGLMAYLNSWQPSPRLDR*
Coding >OphauB2|6662
ATGACCGCCGTGGCCAGTCCACCGGCCTTTCCTCAAATTTCTCGAGCAGCATGGGGCATCGGTAGCGACAATCAA
TCCACTAGCCCCGAGACTACGAGAGGCATGTTTGGGACACGGAAGCCGCTTTCGCGTACCAACTCTTCATCCTCC
ATCTCGTCCAACTCTTCAAACTCTACAGTAACATCCAACGGCTCACACATTAATGGCACGGCCGCGTCTGCTTCT
GAGCTTGGCCAATGGTCCGACTTATCGAGGATCCCCGCGGGCCGTGTCAACGGCTTGGGGACGTCGCCTCATTTA
GCTGCGATGCAGTCAGCCTCGGGTCCCCCGCAGATGGCTCCGCAGCAGCAGCAACAGCAACAGCAGTATCCTCAA
CAACAGCCATTCATGCGAGCCATGCCTTCAGAACAATTTTCCCCCAGCCAACCCATGCTATATACCCTGCGCATT
GGCAGGCAGACGAACCAAAAGACGGTTCCGACTACAGTCAATGGCTTCTTTGATAGCAAAGTGTTGTCAAGACAA
CACGCTGAGATATTTGCCGAACGCAACGGCAAGGTCTATATCCGGGATATCAAGTCTTCCAATGGCACGTTTGTG
AATGGCACACGTCTTTCACAAGAGAATCGTGAATCCGAGCCTCACGAATTGCAGACTAGTGATCAACTTGAACTT
GGTATCGACATTGTCAGTGAAGACCAAAAGACGGTGATTCATCACAAAGTTGCTGCCAGGGTTGAGCATGCTGGT
TTTGCAAGCAACACTAACAATGTCTTGGACATGAGCTTTGGCGACCTTGATCCAGCCAACGGATCTATGCTCGTT
CCTAATGGTTCCTTGCAAATGCGTGGTAGGACTGGGAGTAATGCTTCCACCCTTAGCGGCGGCCGGATGACACCC
AGTGCTGGAGCAACAGGTGGTGTTGGCGTGGCGGGAGCATCTCAACAGCGGCCTTTTTTTGTGTCGCCCGTTGCT
ACGGATCAAATAATCAAACGACTCGCTAATGAGATTCGCAACGCCCGGTTACAGGCTCAAGATTTGAATCGCACG
CACCAGTTTGTCAAAACGCTCTTGTCGAAGGAGGACATTAAAGATCTTGAAAGGCCAGAGCCTCGGCCAGAGCCT
CGGCCAGAGCCTTCTAGACCACCTGTTCACCCCGTTACTAACGGCAGCTCGATGCGAGCCGATGCACGAACTAGA
TTTTCTGACCCACCGGCTCCTCCGCCGCAACAGCCACTGCCAGAGAAGCCTGATGTGCCATCGTTGAGACGCGGC
GCTTCAGATCGGCCAAGAGCAAGTGGCATGTCACCTCGTCAAGAGAACCTAAGCCAGATTATTCAGCTCACCGAA
GCCCTTAATAATGCCAAGCGTGATATTGACTCTCAAACTACACGCATGCAAGAATTAGAGATTATGCTCCAAAGA
GAACGAGAGGCGCGAGAGGTGGCTGAGGATGTGGCCAGGAGACTGGAAGCGGCTGCAAGCGTTCTTCACGTTAAG
GACGTTGGCCAGCCAGATGACTTGGAAGAACATGCCAGCTTGAATATCCAGTCAACTGCACAGTCAGAGGAGCGA
GGTGCTTTGACAGACCAGGAACACGCTTCCATGATGGATCCAACGGACGCAGCAAGAGAGACGGTAGTGGCCCTT
CAATCCCGCGTCGAAAACATGGAATCACAAATGATGGACCTTCGACAGCACGTTGAAATGTGGAAGCGGCGCAGT
GAAACAGCAGAATCGGAGCGTGACGAAAGCCGGCAAACCTTGGCGGAAATGGTGCTGAAGCTTAGAGTGGAAGAG
TCCAGACGGGCAACTGCAGAAGCAAAAAGCCGGTCACGGTCGAGGCACGCGCGTTCAAGACAGCGGGCACCAGGA
CCTGATGATGAAACATCATCGGCCTCTCATGTAGATGGACCTGCTGCAACTCCTTTCTCGAAACAGTTGCCAGTG
GATGGCCCATTACAAGATGATCCTGGAGATTGCGACGAACAAACTTCTCAAACGAACCCACCTTCAAGTACTGAT
GATTCACAGAACGTGCAGACACACATGCATGCGGCACTGCCCTATGCCTCCATGATTGGAGTGGTACTGGTTGGA
ATGGGTTTGATGGCATATCTGAACAGCTGGCAGCCGTCTCCTCGCTTGGATAGGTGA
Transcript >OphauB2|6662
ATGACCGCCGTGGCCAGTCCACCGGCCTTTCCTCAAATTTCTCGAGCAGCATGGGGCATCGGTAGCGACAATCAA
TCCACTAGCCCCGAGACTACGAGAGGCATGTTTGGGACACGGAAGCCGCTTTCGCGTACCAACTCTTCATCCTCC
ATCTCGTCCAACTCTTCAAACTCTACAGTAACATCCAACGGCTCACACATTAATGGCACGGCCGCGTCTGCTTCT
GAGCTTGGCCAATGGTCCGACTTATCGAGGATCCCCGCGGGCCGTGTCAACGGCTTGGGGACGTCGCCTCATTTA
GCTGCGATGCAGTCAGCCTCGGGTCCCCCGCAGATGGCTCCGCAGCAGCAGCAACAGCAACAGCAGTATCCTCAA
CAACAGCCATTCATGCGAGCCATGCCTTCAGAACAATTTTCCCCCAGCCAACCCATGCTATATACCCTGCGCATT
GGCAGGCAGACGAACCAAAAGACGGTTCCGACTACAGTCAATGGCTTCTTTGATAGCAAAGTGTTGTCAAGACAA
CACGCTGAGATATTTGCCGAACGCAACGGCAAGGTCTATATCCGGGATATCAAGTCTTCCAATGGCACGTTTGTG
AATGGCACACGTCTTTCACAAGAGAATCGTGAATCCGAGCCTCACGAATTGCAGACTAGTGATCAACTTGAACTT
GGTATCGACATTGTCAGTGAAGACCAAAAGACGGTGATTCATCACAAAGTTGCTGCCAGGGTTGAGCATGCTGGT
TTTGCAAGCAACACTAACAATGTCTTGGACATGAGCTTTGGCGACCTTGATCCAGCCAACGGATCTATGCTCGTT
CCTAATGGTTCCTTGCAAATGCGTGGTAGGACTGGGAGTAATGCTTCCACCCTTAGCGGCGGCCGGATGACACCC
AGTGCTGGAGCAACAGGTGGTGTTGGCGTGGCGGGAGCATCTCAACAGCGGCCTTTTTTTGTGTCGCCCGTTGCT
ACGGATCAAATAATCAAACGACTCGCTAATGAGATTCGCAACGCCCGGTTACAGGCTCAAGATTTGAATCGCACG
CACCAGTTTGTCAAAACGCTCTTGTCGAAGGAGGACATTAAAGATCTTGAAAGGCCAGAGCCTCGGCCAGAGCCT
CGGCCAGAGCCTTCTAGACCACCTGTTCACCCCGTTACTAACGGCAGCTCGATGCGAGCCGATGCACGAACTAGA
TTTTCTGACCCACCGGCTCCTCCGCCGCAACAGCCACTGCCAGAGAAGCCTGATGTGCCATCGTTGAGACGCGGC
GCTTCAGATCGGCCAAGAGCAAGTGGCATGTCACCTCGTCAAGAGAACCTAAGCCAGATTATTCAGCTCACCGAA
GCCCTTAATAATGCCAAGCGTGATATTGACTCTCAAACTACACGCATGCAAGAATTAGAGATTATGCTCCAAAGA
GAACGAGAGGCGCGAGAGGTGGCTGAGGATGTGGCCAGGAGACTGGAAGCGGCTGCAAGCGTTCTTCACGTTAAG
GACGTTGGCCAGCCAGATGACTTGGAAGAACATGCCAGCTTGAATATCCAGTCAACTGCACAGTCAGAGGAGCGA
GGTGCTTTGACAGACCAGGAACACGCTTCCATGATGGATCCAACGGACGCAGCAAGAGAGACGGTAGTGGCCCTT
CAATCCCGCGTCGAAAACATGGAATCACAAATGATGGACCTTCGACAGCACGTTGAAATGTGGAAGCGGCGCAGT
GAAACAGCAGAATCGGAGCGTGACGAAAGCCGGCAAACCTTGGCGGAAATGGTGCTGAAGCTTAGAGTGGAAGAG
TCCAGACGGGCAACTGCAGAAGCAAAAAGCCGGTCACGGTCGAGGCACGCGCGTTCAAGACAGCGGGCACCAGGA
CCTGATGATGAAACATCATCGGCCTCTCATGTAGATGGACCTGCTGCAACTCCTTTCTCGAAACAGTTGCCAGTG
GATGGCCCATTACAAGATGATCCTGGAGATTGCGACGAACAAACTTCTCAAACGAACCCACCTTCAAGTACTGAT
GATTCACAGAACGTGCAGACACACATGCATGCGGCACTGCCCTATGCCTCCATGATTGGAGTGGTACTGGTTGGA
ATGGGTTTGATGGCATATCTGAACAGCTGGCAGCCGTCTCCTCGCTTGGATAGGTGA
Gene >OphauB2|6662
ATGACCGCCGTGGCCAGTCCACCGGCCTTTCCTCAAATTTCTCGAGCAGCATGGGGCATCGGTAGCGACAATCAA
TCCACTAGCCCCGAGACTACGAGAGGCATGTTTGGGACACGGAAGCCGCTTTCGCGTACCAACTCTTCATCCTCC
ATCTCGTCCAACTCTTCAAACTCTACAGTAACATCCAACGGCTCACACATTAATGGCACGGCCGCGTCTGCTTCT
GAGCTTGGCCAATGGGTAGGCAACAACGTTTCTCGCAAGCGACCTCAGCCCAAAAACAGTAGCAGCCCCTGGACT
CCTAATAAGGCCGAAGCTCAGTCCGACTTATCGAGGATCCCCGCGGGCCGTGTCAACGGCTTGGGGACGTCGCCT
CATTTAGCTGCGATGCAGTCAGCCTCGGGTCCCCCGCAGATGGCTCCGCAGCAGCAGCAACAGCAACAGCAGTAT
CCTCAACAACAGCCATTCATGCGAGCCATGCCTTCAGAACAATTTTCCCCCAGCCAACCCATGCTATGTCTTCTT
TCTTTGAATGGTACATTTGAACGAAAAACAATTGCCGTGCCCTTTTCTCCAGATACCCTGCGCATTGGCAGGCAG
ACGAACCAAAAGACGGTTCCGACTACAGTCAATGGCTTCTTTGATAGCAAAGTGTTGTCAAGACAACACGCTGAG
ATATTTGCCGAACGCAACGGCAAGGTCTATATCCGGGATATCAAGTCTTCCAATGGCACGTTTGTGAATGGCACA
CGTCTTTCACAAGAGAATCGTGAATCCGAGCCTCACGAATTGCAGACTAGTGATCAACTTGAACTTGGTATCGAC
ATTGTCAGTGAAGACCAAAAGACGGTGATTCATCACAAAGTTGCTGCCAGGGTTGAGCATGCTGGTTTTGCAAGC
AACACTAACAATGTCTTGGACATGAGCTTTGGCGACCTTGATCCAGCCAACGGATCTATGCTCGTTCCTAATGGT
TCCTTGCAAATGCGTGGTAGGACTGGGAGTAATGCTTCCACCCTTAGCGGCGGCCGGATGACACCCAGTGCTGGA
GCAACAGGTGGTGTTGGCGTGGCGGGAGCATCTCAACAGCGGCCTTTTTTTGTGTCGCCCGTTGCTACGGATCAA
ATAATCAAACGACTCGCTGTAAGTACTGGCGAAATCTTGCTTGTTGCAGACTCTATCTAACCTCTATTTTATAGA
ATGAGATTCGCAACGCCCGGTTACAGGCTCAAGATTTGAATCGCACGCACCAGTTTGTCAAAACGCTCTTGTCGA
AGGAGGACATTAAAGATCTTGAAAGGCCAGAGCCTCGGCCAGAGCCTCGGCCAGAGCCTTCTAGACCACCTGTTC
ACCCCGTTACTAACGGCAGCTCGATGCGAGCCGATGCACGAACTAGATTTTCTGACCCACCGGCTCCTCCGCCGC
AACAGCCACTGCCAGAGAAGCCTGATGTGCCATCGTTGAGACGCGGCGCTTCAGATCGGCCAAGAGCAAGTGGCA
TGTCACCTCGTCAAGAGAACCTAAGCCAGATTATTCAGCTCACCGAAGCCCTTAATAATGCCAAGCGTGATATTG
ACTCTCAAACTACACGCATGCAAGAATTAGAGATTATGCTCCAAAGAGAACGAGAGGCGCGAGAGGTGGCTGAGG
ATGTGGCCAGGAGACTGGAAGCGGCTGCAAGCGTTCTTCACGTTAAGGACGTTGGCCAGCCAGATGACTTGGAAG
AACATGCCAGCTTGAATATCCAGTCAACTGCACAGTCAGAGGAGCGAGGTGCTTTGACAGACCAGGAACACGCTT
CCATGATGGATCCAACGGACGCAGCAAGAGAGACGGTAGTGGCCCTTCAATCCCGCGTCGAAAACATGGAATCAC
AAATGATGGACCTTCGACAGCACGTTGAAATGTGGAAGCGGCGCAGTGAAACAGCAGAATCGGAGCGTGACGAAA
GCCGGCAAACCTTGGCGGAAATGGTGCTGAAGCTTAGAGTGGAAGAGTCCAGACGGGCAACTGCAGAAGCAAAAA
GCCGGTCACGGTCGAGGCACGCGCGTTCAAGACAGCGGGCACCAGGACCTGATGATGAAACATCATCGGCCTCTC
ATGTAGATGGACCTGCTGCAACTCCTTTCTCGAAACAGTTGCCAGTGGATGGCCCATTACAAGATGATCCTGGAG
ATTGCGACGAACAAACTTCTCAAACGAACCCACCTTCAAGTACTGATGATTCACAGAACGTGCAGACACACATGC
ATGCGGCACTGCCCTATGCCTCCATGATTGGAGTGGTACTGGTTGGAATGGGTTTGATGGCATATCTGAACAGCT
GGCAGCCGTCTCCTCGCTTGGATAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail