Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6658
Gene name
LocationContig_62:90187..90820
Strand-
Gene length (bp)633
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03371 PRP38 PRP38 family 7.4E-59 27 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RDD2|PR38A_PONAB Pre-mRNA-splicing factor 38A OS=Pongo abelii GN=PRPF38A PE=2 SV=1 27 201 2.0E-46
sp|Q8HXH6|PR38A_MACFA Pre-mRNA-splicing factor 38A OS=Macaca fascicularis GN=PRPF38A PE=2 SV=1 27 201 2.0E-46
sp|Q8NAV1|PR38A_HUMAN Pre-mRNA-splicing factor 38A OS=Homo sapiens GN=PRPF38A PE=1 SV=1 27 201 2.0E-46
sp|Q0P5I6|PR38A_BOVIN Pre-mRNA-splicing factor 38A OS=Bos taurus GN=PRPF38A PE=2 SV=1 27 201 2.0E-46
sp|Q6DHU4|PR38A_DANRE Pre-mRNA-splicing factor 38A OS=Danio rerio GN=prpf38a PE=2 SV=1 27 201 5.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RDD2|PR38A_PONAB Pre-mRNA-splicing factor 38A OS=Pongo abelii GN=PRPF38A PE=2 SV=1 27 201 2.0E-46
sp|Q8HXH6|PR38A_MACFA Pre-mRNA-splicing factor 38A OS=Macaca fascicularis GN=PRPF38A PE=2 SV=1 27 201 2.0E-46
sp|Q8NAV1|PR38A_HUMAN Pre-mRNA-splicing factor 38A OS=Homo sapiens GN=PRPF38A PE=1 SV=1 27 201 2.0E-46
sp|Q0P5I6|PR38A_BOVIN Pre-mRNA-splicing factor 38A OS=Bos taurus GN=PRPF38A PE=2 SV=1 27 201 2.0E-46
sp|Q6DHU4|PR38A_DANRE Pre-mRNA-splicing factor 38A OS=Danio rerio GN=prpf38a PE=2 SV=1 27 201 5.0E-46
sp|Q4FZQ6|PR38A_XENLA Pre-mRNA-splicing factor 38A OS=Xenopus laevis GN=prpf38a PE=2 SV=1 27 201 7.0E-46
sp|Q28H87|PR38A_XENTR Pre-mRNA-splicing factor 38A OS=Xenopus tropicalis GN=prpf38a PE=2 SV=1 27 201 3.0E-44
sp|Q4FK66|PR38A_MOUSE Pre-mRNA-splicing factor 38A OS=Mus musculus GN=Prpf38a PE=1 SV=1 27 201 4.0E-44
sp|Q8LB54|PRP38_ARATH Pre-mRNA-splicing factor 38 OS=Arabidopsis thaliana GN=PRP38 PE=1 SV=1 24 201 5.0E-42
sp|Q9UUD2|PRP38_SCHPO Pre-mRNA-splicing factor 38 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp38 PE=3 SV=1 14 179 5.0E-41
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6658
MSKPDVIYADARRFLDERGSSADLAPNGLNPATIMEKAVRDRIVESYFYKEQCFALNEADIIDRVVDHVSFIGGT
HGAAQKPSPFLCLAFKLLQLAPSDAILQQYLEYGGQHYKYLRALACFYIRLTRPAVDVYRTLEPYLADRRKLRRR
RRDNKAELAFVDEFVDDLLNKERVCATSLWKMPKREALEDAEVLEPRVSPLGDLDEQLSD*
Coding >OphauB2|6658
ATGTCCAAGCCAGATGTCATCTACGCCGATGCCCGCCGCTTCCTCGACGAGCGCGGCTCCTCGGCCGACCTGGCC
CCCAATGGCCTCAACCCCGCCACCATAATGGAAAAAGCCGTGCGCGACCGCATCGTCGAATCCTACTTTTACAAG
GAACAATGCTTTGCCCTCAACGAAGCCGACATTATCGACCGCGTCGTTGACCACGTCTCCTTTATCGGCGGCACC
CACGGCGCCGCCCAGAAACCCAGCCCTTTTCTCTGCCTCGCCTTTAAACTCCTCCAACTCGCTCCCTCGGACGCC
ATTCTCCAACAGTACCTCGAATACGGCGGCCAGCACTACAAGTACCTCCGCGCCCTCGCCTGCTTCTACATTCGC
CTCACCCGGCCCGCCGTGGACGTTTACCGTACCCTGGAGCCCTACTTGGCGGATCGGAGGAAGCTGCGCAGGCGC
CGCAGGGATAACAAGGCGGAGCTGGCGTTTGTGGATGAGTTTGTGGATGATTTGCTAAACAAGGAGCGCGTGTGT
GCCACGAGTTTGTGGAAGATGCCCAAGCGTGAGGCGCTCGAGGATGCAGAGGTGTTGGAGCCGCGCGTCAGTCCG
CTGGGAGATCTCGATGAACAGTTGTCTGATTAA
Transcript >OphauB2|6658
ATGTCCAAGCCAGATGTCATCTACGCCGATGCCCGCCGCTTCCTCGACGAGCGCGGCTCCTCGGCCGACCTGGCC
CCCAATGGCCTCAACCCCGCCACCATAATGGAAAAAGCCGTGCGCGACCGCATCGTCGAATCCTACTTTTACAAG
GAACAATGCTTTGCCCTCAACGAAGCCGACATTATCGACCGCGTCGTTGACCACGTCTCCTTTATCGGCGGCACC
CACGGCGCCGCCCAGAAACCCAGCCCTTTTCTCTGCCTCGCCTTTAAACTCCTCCAACTCGCTCCCTCGGACGCC
ATTCTCCAACAGTACCTCGAATACGGCGGCCAGCACTACAAGTACCTCCGCGCCCTCGCCTGCTTCTACATTCGC
CTCACCCGGCCCGCCGTGGACGTTTACCGTACCCTGGAGCCCTACTTGGCGGATCGGAGGAAGCTGCGCAGGCGC
CGCAGGGATAACAAGGCGGAGCTGGCGTTTGTGGATGAGTTTGTGGATGATTTGCTAAACAAGGAGCGCGTGTGT
GCCACGAGTTTGTGGAAGATGCCCAAGCGTGAGGCGCTCGAGGATGCAGAGGTGTTGGAGCCGCGCGTCAGTCCG
CTGGGAGATCTCGATGAACAGTTGTCTGATTAA
Gene >OphauB2|6658
ATGTCCAAGCCAGATGTCATCTACGCCGATGCCCGCCGCTTCCTCGACGAGCGCGGCTCCTCGGCCGACCTGGCC
CCCAATGGCCTCAACCCCGCCACCATAATGGAAAAAGCCGTGCGCGACCGCATCGTCGAATCCTACTTTTACAAG
GAACAATGCTTTGCCCTCAACGAAGCCGACATTATCGACCGCGTCGTTGACCACGTCTCCTTTATCGGCGGCACC
CACGGCGCCGCCCAGAAACCCAGCCCTTTTCTCTGCCTCGCCTTTAAACTCCTCCAACTCGCTCCCTCGGACGCC
ATTCTCCAACAGTACCTCGAATACGGCGGCCAGCACTACAAGTACCTCCGCGCCCTCGCCTGCTTCTACATTCGC
CTCACCCGGCCCGCCGTGGACGTTTACCGTACCCTGGAGCCCTACTTGGCGGATCGGAGGAAGCTGCGCAGGCGC
CGCAGGGATAACAAGGCGGAGCTGGCGTTTGTGGATGAGTTTGTGGATGATTTGCTAAACAAGGAGCGCGTGTGT
GCCACGAGTTTGTGGAAGATGCCCAAGCGTGAGGCGCTCGAGGATGCAGAGGTGTTGGAGCCGCGCGTCAGTCCG
CTGGGAGATCTCGATGAACAGTTGTCTGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail