Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6651
Gene name
LocationContig_62:75399..77637
Strand+
Gene length (bp)2238
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 5.5E-150 101 645

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 52 650 9.0E-177
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 80 651 4.0E-157
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 26 653 3.0E-131
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 68 653 5.0E-131
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 80 653 4.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 52 650 9.0E-177
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 80 651 4.0E-157
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 26 653 3.0E-131
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 68 653 5.0E-131
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 80 653 4.0E-125
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 79 649 4.0E-124
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 80 648 7.0E-124
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 82 649 1.0E-121
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 71 650 2.0E-121
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 66 649 2.0E-120
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 70 649 8.0E-118
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 51 649 4.0E-115
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 66 649 2.0E-104
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 2 643 2.0E-80
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0042887 amide transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 104 126 22
2 139 161 22
3 176 198 22
4 210 229 19
5 233 255 22
6 276 307 31
7 322 344 22
8 349 371 22
9 425 447 22
10 477 499 22
11 504 526 22
12 533 555 22
13 586 608 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6651
MGLRDKLAFRSTEADVETTPPVSAISTGAEVTPAPELRRFRKQHKWDPFLDSSKLDKIDDALVTGDGDKEAAIDE
TLIQEDSPYAEVRASVPPIDIDMPINTIRAWTIGAVLCTIVAACNILLSLRRTPISISSTVVQLIAYPIGCAWAK
YMPAATFTLLGRTFELNPGPFNLKEHTIITMMTAAGSSISYSIDILLAQEIFYKQNFKWGFQILLMLSTQAMGFG
IAGIARRFLVWPSSMVWPATLITCTVMYSLHDHRPSDPSQTNGWRIGRYSLFLAIACVTFVWEWFPLVIAPFLSY
FMFATWIAPRNVLVNQVLGGNTGLGLIPVSFDWASVTAFLGSPLQTPAFAIVNVAAGLLLATLGAIGLAYGGPEF
YRYLPISANNNFDRFAQEYDTKRILTPDFQINETAYKEYSPILLGATFSMSYGLSFATLIATITHVALFYGSDVW
GRIWDSKYEEPDVHLKLMRKYKEAPEWWFASIFIVSFAFGMIASQVWQTHLPWWAYIICILIGVIFFVPIGMVQA
ITNQQTGLNVITEMIIGYMLPGRPVAMMLFKSWGYMLSFNGLTYISDMKVGHYMKIPPRSMFAAQAFAVVWLSFV
QIATYNFLRGNIDGICTKEQTQGLTCPGARTFFNASVIWGLVGPKRVFGAGAV*
Coding >OphauB2|6651
ATGGGGCTGAGAGACAAGTTGGCCTTTCGGTCAACCGAGGCCGATGTCGAGACGACGCCGCCCGTGAGTGCCATT
AGCACTGGCGCCGAAGTGACGCCCGCGCCAGAGCTGCGGCGCTTCCGCAAGCAGCACAAATGGGATCCCTTTTTG
GATAGCAGCAAGCTGGACAAGATTGACGATGCGCTCGTGACTGGCGATGGCGACAAGGAGGCGGCCATTGACGAG
ACGCTGATTCAGGAGGACTCGCCGTACGCTGAAGTGCGCGCTTCGGTGCCGCCCATTGACATTGACATGCCCATC
AATACGATTCGCGCGTGGACCATTGGCGCCGTCTTGTGCACCATTGTGGCAGCGTGCAACATTCTGCTCAGTCTG
CGGCGCACGCCCATTTCCATATCGTCAACCGTGGTGCAGCTGATTGCATATCCCATTGGCTGCGCGTGGGCGAAA
TATATGCCCGCAGCAACCTTTACCCTCTTGGGCCGGACCTTTGAGCTCAACCCGGGGCCGTTTAACCTCAAGGAG
CACACCATTATAACCATGATGACGGCTGCGGGATCGTCGATTAGCTATTCGATTGATATTCTGCTTGCGCAAGAA
ATCTTTTACAAGCAAAACTTCAAATGGGGCTTCCAGATCCTGCTCATGCTCTCCACGCAGGCCATGGGCTTTGGC
ATCGCGGGCATCGCGCGCCGCTTCCTCGTCTGGCCGTCGTCCATGGTCTGGCCGGCGACACTCATCACCTGCACC
GTCATGTATTCTCTCCACGACCACCGCCCCTCTGATCCGTCGCAAACAAACGGCTGGCGGATTGGGCGATATAGC
CTCTTCCTCGCCATTGCCTGCGTCACATTTGTCTGGGAATGGTTCCCGCTCGTCATTGCGCCCTTTTTGAGCTAC
TTCATGTTCGCCACGTGGATTGCACCGCGCAACGTCCTTGTCAACCAGGTGCTGGGCGGCAACACGGGGCTCGGG
CTCATACCCGTTTCCTTTGACTGGGCCAGCGTCACGGCCTTTTTGGGCAGTCCGCTGCAGACGCCTGCCTTTGCC
ATTGTAAACGTGGCGGCCGGCCTGCTGCTGGCCACGCTGGGAGCCATTGGGCTGGCGTATGGAGGGCCAGAGTTT
TATAGATATCTGCCCATCAGCGCCAATAACAATTTCGACCGCTTTGCCCAAGAGTACGACACCAAGCGTATCCTG
ACGCCCGACTTCCAGATCAACGAAACCGCCTACAAGGAATACTCGCCCATTCTGCTCGGCGCCACCTTTTCCATG
TCGTACGGCCTTTCCTTTGCCACGCTTATTGCCACTATTACCCACGTTGCCCTCTTTTACGGCTCCGATGTCTGG
GGCCGCATCTGGGATTCCAAGTACGAGGAACCCGACGTGCATCTCAAGCTCATGAGAAAGTATAAAGAGGCCCCC
GAGTGGTGGTTTGCTAGCATCTTCATCGTTAGCTTTGCCTTTGGCATGATTGCCAGCCAGGTATGGCAGACGCAC
CTGCCGTGGTGGGCCTATATTATTTGCATCCTTATTGGCGTCATCTTCTTTGTGCCCATTGGCATGGTGCAGGCC
ATTACCAACCAGCAGACGGGGCTCAACGTCATCACGGAAATGATTATCGGCTACATGCTCCCGGGGCGGCCCGTG
GCCATGATGCTCTTTAAGAGCTGGGGGTATATGCTCTCCTTCAACGGCCTAACCTATATTTCGGATATGAAGGTT
GGCCACTACATGAAGATTCCGCCGCGGAGCATGTTTGCCGCCCAAGCCTTTGCCGTCGTCTGGCTGTCCTTTGTG
CAGATTGCCACGTATAATTTCTTGCGTGGCAATATCGACGGTATTTGCACAAAGGAGCAGACCCAGGGACTGACT
TGTCCCGGAGCGCGCACTTTTTTCAACGCCAGCGTCATCTGGGGCCTGGTTGGGCCAAAACGCGTCTTTGGCGCC
GGCGCAGTGTAA
Transcript >OphauB2|6651
ATGGGGCTGAGAGACAAGTTGGCCTTTCGGTCAACCGAGGCCGATGTCGAGACGACGCCGCCCGTGAGTGCCATT
AGCACTGGCGCCGAAGTGACGCCCGCGCCAGAGCTGCGGCGCTTCCGCAAGCAGCACAAATGGGATCCCTTTTTG
GATAGCAGCAAGCTGGACAAGATTGACGATGCGCTCGTGACTGGCGATGGCGACAAGGAGGCGGCCATTGACGAG
ACGCTGATTCAGGAGGACTCGCCGTACGCTGAAGTGCGCGCTTCGGTGCCGCCCATTGACATTGACATGCCCATC
AATACGATTCGCGCGTGGACCATTGGCGCCGTCTTGTGCACCATTGTGGCAGCGTGCAACATTCTGCTCAGTCTG
CGGCGCACGCCCATTTCCATATCGTCAACCGTGGTGCAGCTGATTGCATATCCCATTGGCTGCGCGTGGGCGAAA
TATATGCCCGCAGCAACCTTTACCCTCTTGGGCCGGACCTTTGAGCTCAACCCGGGGCCGTTTAACCTCAAGGAG
CACACCATTATAACCATGATGACGGCTGCGGGATCGTCGATTAGCTATTCGATTGATATTCTGCTTGCGCAAGAA
ATCTTTTACAAGCAAAACTTCAAATGGGGCTTCCAGATCCTGCTCATGCTCTCCACGCAGGCCATGGGCTTTGGC
ATCGCGGGCATCGCGCGCCGCTTCCTCGTCTGGCCGTCGTCCATGGTCTGGCCGGCGACACTCATCACCTGCACC
GTCATGTATTCTCTCCACGACCACCGCCCCTCTGATCCGTCGCAAACAAACGGCTGGCGGATTGGGCGATATAGC
CTCTTCCTCGCCATTGCCTGCGTCACATTTGTCTGGGAATGGTTCCCGCTCGTCATTGCGCCCTTTTTGAGCTAC
TTCATGTTCGCCACGTGGATTGCACCGCGCAACGTCCTTGTCAACCAGGTGCTGGGCGGCAACACGGGGCTCGGG
CTCATACCCGTTTCCTTTGACTGGGCCAGCGTCACGGCCTTTTTGGGCAGTCCGCTGCAGACGCCTGCCTTTGCC
ATTGTAAACGTGGCGGCCGGCCTGCTGCTGGCCACGCTGGGAGCCATTGGGCTGGCGTATGGAGGGCCAGAGTTT
TATAGATATCTGCCCATCAGCGCCAATAACAATTTCGACCGCTTTGCCCAAGAGTACGACACCAAGCGTATCCTG
ACGCCCGACTTCCAGATCAACGAAACCGCCTACAAGGAATACTCGCCCATTCTGCTCGGCGCCACCTTTTCCATG
TCGTACGGCCTTTCCTTTGCCACGCTTATTGCCACTATTACCCACGTTGCCCTCTTTTACGGCTCCGATGTCTGG
GGCCGCATCTGGGATTCCAAGTACGAGGAACCCGACGTGCATCTCAAGCTCATGAGAAAGTATAAAGAGGCCCCC
GAGTGGTGGTTTGCTAGCATCTTCATCGTTAGCTTTGCCTTTGGCATGATTGCCAGCCAGGTATGGCAGACGCAC
CTGCCGTGGTGGGCCTATATTATTTGCATCCTTATTGGCGTCATCTTCTTTGTGCCCATTGGCATGGTGCAGGCC
ATTACCAACCAGCAGACGGGGCTCAACGTCATCACGGAAATGATTATCGGCTACATGCTCCCGGGGCGGCCCGTG
GCCATGATGCTCTTTAAGAGCTGGGGGTATATGCTCTCCTTCAACGGCCTAACCTATATTTCGGATATGAAGGTT
GGCCACTACATGAAGATTCCGCCGCGGAGCATGTTTGCCGCCCAAGCCTTTGCCGTCGTCTGGCTGTCCTTTGTG
CAGATTGCCACGTATAATTTCTTGCGTGGCAATATCGACGGTATTTGCACAAAGGAGCAGACCCAGGGACTGACT
TGTCCCGGAGCGCGCACTTTTTTCAACGCCAGCGTCATCTGGGGCCTGGTTGGGCCAAAACGCGTCTTTGGCGCC
GGCGCAGTGTAA
Gene >OphauB2|6651
ATGGGGCTGAGAGACAAGTTGGCCTTTCGGTCAACCGAGGCCGATGTCGAGACGACGCCGCCCGTGAGTGCCATT
AGCACTGGCGCCGAAGTGACGCCCGCGCCAGAGCTGCGGCGCTTCCGCAAGCAGCACAAATGGGATCCCTTTTTG
GATAGCAGCAAGCTGGACAAGATTGACGATGCGCTCGTGACTGGCGATGGCGACAAGGAGGCGGCCATTGACGAG
ACGCTGATTCAGGAGGACTCGCCGTACGCTGAAGTGCGCGCTTCGGTGAGTAGATGTGGCGCGTGGTGTTTTTTT
TTTTTTTTCCTTTTTTTTGGGGTAGCCGCTCAAGGAAGAGTGCTGCTTGCTAGTGGTTGACAATGGGCAAAGAGT
ATTCTGACGAGGCGTGCGGGATTCTAGGTGCCGCCCATTGACATTGACATGCCCATCAATACGATTCGCGCGTGG
ACCATTGGCGCCGTCTTGTGCACCATTGTGGCAGCGTGCAACATTCTGCTCAGTCTGCGGCGCACGCCCATTTCC
ATATCGTCAACCGTGGTGCAGCTGATTGCATATCCGTGTGTACAAGAGTATTCACTGGCGAGAGTATTCACTCTC
GGCATCGGGGACATGAGCTGACTTGAGCTTGTAGCATTGGCTGCGCGTGGGCGAAATATATGCCCGCAGCAACCT
TTACCCTCTTGGGCCGGACCTTTGAGCTCAACCCGGGGCCGTTTAACCTCAAGGAGCACACCATTATAACCATGA
TGACGGCTGCGGGATCGTCGATTAGCTATTCGATTGATATTCTGCTTGCGCAAGAAATCTTTTACAAGCAAAACT
TCAAGTTAGTCGAGAGGATAAAAAAAAGGGGGGGGCTTACGGGCCGAGGCAATCAACTGACGAGCTTGCACTAGA
TGGGGCTTCCAGATCCTGCTCATGCTCTCCACGCAGGCCATGGGCTTTGGCATCGCGGGCATCGCGCGCCGCTTC
CTCGTCTGGCCGTCGTCCATGGTCTGGCCGGCGACACTCATCACCTGCACCGTCATGTATTCTCTCCACGACCAC
CGCCCCTCTGATCCGTCGCAAACAAACGGCTGGCGGATTGGGCGATATAGCCTCTTCCTCGCCATTGCCTGCGTC
ACATTTGTCTGGGAATGGTTCCCGCTCGTCATTGCGCCCTTTTTGAGCTACTTCATGTTCGCCACGTGGATTGCA
CCGCGCAACGTCCTTGTCAACCAGGTGCTGGGCGGCAACACGGGGCTCGGGCTCATACCCGTTTCCTTTGACTGG
GCCAGCGTCACGGCCTTTTTGGGCAGTCCGCTGCAGACGCCTGCCTTTGCCATTGTAAACGTGGCGGCCGGCCTG
CTGCTGGCCACGCTGGGAGCCATTGGGCTGGCGTATGGAGGGCCAGAGTTTTATAGATATCTGCCCATCAGCGCC
AATAACAATTTCGACCGCTTTGCCCAAGAGTACGACACCAAGCGTATCCTGACGCCCGACTTCCAGATCAACGAA
ACCGCCTACAAGGAATACTCGCCCATTCTGCTCGGCGCCACCTTTTCCATGTCGTACGGCCTTTCCTTTGCCACG
CTTATTGCCACTATTACCCACGTTGCCCTCTTTTACGGCTCCGATGTCTGGGGCCGCATCTGGGATTCCAAGTAC
GAGGAACCCGACGTGCATCTCAAGCTCATGAGAAAGTATAAAGAGGCCCCCGAGTGGTGGTTTGCTAGCATCTTC
ATCGTTAGCTTTGCCTTTGGCATGATTGCCAGCCAGGTATGGCAGACGCACCTGCCGTGGTGGGCCTATATTATT
TGCATCCTTATTGGCGTCATCTTCTTTGTGCCCATTGGCATGGTGCAGGCCATTACCAACCAGCAGACGGGGCTC
AACGTCATCACGGAAATGATTATCGGCTACATGCTCCCGGGGCGGCCCGTGGCCATGATGCTCTTTAAGAGCTGG
GGGTATATGCTCTCCTTCAACGGCCTAACCTATATTTCGGATATGAAGGTTGGCCACTACATGAAGATTCCGCCG
CGGAGCATGTTTGCCGCCCAAGCCTTTGCCGTCGTCTGGCTGTCCTTTGTGCAGATTGCCACGTATAATTTCTTG
CGTGGCAATATCGACGGTATTTGCACAAAGGAGCAGACCCAGGGACTGACTTGTCCCGGAGCGCGCACTTTTTTC
AACGCCAGCGTCATCTGGGGCCTGGTTGGGCCAAAACGCGTCTTTGGCGCCGGCGCAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail