Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6649
Gene name
LocationContig_62:65065..66287
Strand-
Gene length (bp)1222
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4GSY9|ANTRB_HALVD Putative ABC transporter anion-binding protein HVO_1888 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_1888 PE=3 SV=1 74 290 3.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6649
MAWLSKFAATVIILLAPAAALNYSAVYHGWMHSCEDAPIKIRIGNGGAGQSGLIQALADTFIQFCLVRGIEPFRI
AWYESDTTYSLASLKTGDIDVAITYNRFAEHEAVKQGYVDDDAPFYIFNDHFLLVGPRANPANLSQDNTVEEMFS
AIFHAAEGEETMPPVRFLSRFDKSATNILESNFWIKIGQVPWANTPSPWYHQFSAFPREALIHAIEYEEYTLTDR
GTFLSLPRYLRNSITVFKAGTDDGNDPLLNAAYLSVGTRAQNVSLARFFGRWTMHPNGQTVIKHFGKGEEPLYSG
SPIRTLDELGRM*
Coding >OphauB2|6649
ATGGCTTGGTTGAGTAAATTCGCAGCCACAGTTATAATCTTGCTGGCCCCCGCGGCGGCCTTGAACTACTCTGCC
GTGTACCACGGCTGGATGCATTCTTGTGAAGATGCACCCATCAAGATACGCATTGGAAATGGTGGCGCCGGCCAA
AGCGGCCTCATCCAAGCTCTGGCAGACACCTTTATCCAATTCTGCCTCGTCCGCGGCATCGAACCCTTTAGAATA
GCATGGTATGAGAGCGATACCACCTACAGCCTCGCCAGCCTCAAGACTGGCGACATTGACGTGGCCATTACATAC
AACCGCTTTGCAGAGCACGAGGCCGTTAAACAAGGCTATGTCGACGATGATGCGCCCTTTTACATCTTCAACGAC
CACTTTCTCCTCGTTGGACCAAGAGCAAACCCCGCAAACCTATCACAAGATAACACTGTTGAAGAAATGTTTTCT
GCAATTTTCCATGCCGCAGAGGGCGAGGAGACGATGCCTCCTGTGCGCTTCCTCAGCCGCTTTGACAAGTCGGCC
ACCAACATTCTAGAATCCAATTTCTGGATCAAGATTGGCCAGGTGCCGTGGGCAAACACCCCCTCTCCATGGTAT
CACCAATTCAGCGCCTTTCCCAGAGAAGCCCTCATCCACGCCATTGAATACGAAGAATACACCCTCACCGACCGC
GGCACCTTTCTCTCTCTTCCACGTTATCTCCGCAACAGCATCACTGTCTTCAAGGCCGGCACCGACGACGGCAAC
GACCCTCTCCTCAACGCCGCTTACTTGTCTGTCGGCACACGGGCGCAAAACGTGTCCTTGGCTAGATTTTTTGGC
AGATGGACAATGCATCCCAATGGCCAGACTGTTATCAAGCACTTTGGAAAGGGTGAAGAACCACTTTATAGCGGT
TCCCCCATTCGAACCCTAGATGAATTGGGGAGGATGTAG
Transcript >OphauB2|6649
ATGGCTTGGTTGAGTAAATTCGCAGCCACAGTTATAATCTTGCTGGCCCCCGCGGCGGCCTTGAACTACTCTGCC
GTGTACCACGGCTGGATGCATTCTTGTGAAGATGCACCCATCAAGATACGCATTGGAAATGGTGGCGCCGGCCAA
AGCGGCCTCATCCAAGCTCTGGCAGACACCTTTATCCAATTCTGCCTCGTCCGCGGCATCGAACCCTTTAGAATA
GCATGGTATGAGAGCGATACCACCTACAGCCTCGCCAGCCTCAAGACTGGCGACATTGACGTGGCCATTACATAC
AACCGCTTTGCAGAGCACGAGGCCGTTAAACAAGGCTATGTCGACGATGATGCGCCCTTTTACATCTTCAACGAC
CACTTTCTCCTCGTTGGACCAAGAGCAAACCCCGCAAACCTATCACAAGATAACACTGTTGAAGAAATGTTTTCT
GCAATTTTCCATGCCGCAGAGGGCGAGGAGACGATGCCTCCTGTGCGCTTCCTCAGCCGCTTTGACAAGTCGGCC
ACCAACATTCTAGAATCCAATTTCTGGATCAAGATTGGCCAGGTGCCGTGGGCAAACACCCCCTCTCCATGGTAT
CACCAATTCAGCGCCTTTCCCAGAGAAGCCCTCATCCACGCCATTGAATACGAAGAATACACCCTCACCGACCGC
GGCACCTTTCTCTCTCTTCCACGTTATCTCCGCAACAGCATCACTGTCTTCAAGGCCGGCACCGACGACGGCAAC
GACCCTCTCCTCAACGCCGCTTACTTGTCTGTCGGCACACGGGCGCAAAACGTGTCCTTGGCTAGATTTTTTGGC
AGATGGACAATGCATCCCAATGGCCAGACTGTTATCAAGCACTTTGGAAAGGGTGAAGAACCACTTTATAGCGGT
TCCCCCATTCGAACCCTAGATGAATTGGGGAGGATGTAG
Gene >OphauB2|6649
ATGGCTTGGTTGAGTAAATTCGCAGCCACAGTTATAATCTTGCTGGCCCCCGCGGCGGCCTTGAACTACTCTGCC
GTGTACCACGGCTGGATGCATTCTTGTGAAGATGCACCCATCAAGATACGCATTGGAAATGGTGGCGCCGGCCAA
AGCGGCCTCATCCAAGGTGCCATTGCCCACCAAACCTTTATCCTCTTTTCCCCTCTTTTTTTGAGATTGCTTTCT
AAAAAAAAACAATCTTTTTTTTTTTTTAAAAAAAAGAATGAAGCAGAAAGAGATTCGCCAAACTAACACGCCTCG
TCTCTCCAGCTCTGGCAGACACCTTTATCCAATTCTGCCTCGTCCGCGGCATCGAACCCTTTAGAATAGCATGGT
ATGAGAGCGATACCACCTACAGCCTCGCCAGCCTCAAGACTGGCGACATTGACGTGGCCATTACATACAACCGCT
TTGCAGAGCACGAGGCCGTTAAACAAGGCTATGTCGACGATGATGCGCCCTTTTACATCTTCAACGACCACTTTC
TCCTCGTTGGACCAAGAGCAAACCCCGCAAACCTATCACAAGATAACACTGTTGAAGAAATGTTTTCTGCAATTT
TCCATGCCGCAGAGGGCGAGGAGACGATGCCTCCTGTGCGCTTCCTCAGCCGCTTTGACAAGTCGGCCACCAACA
TTCTAGAATCCAATTTCTGGATCAAGATTGGCCAGGTATGCTTCCTTGCCACCTCTCTCTCTCTCTCTCTCAAAA
AAGCCCATCTTTTATTCCCCTATGTCGTCTCAACACGCCAGCCCCTTCAACCCTTGCCCATCTTATTCTCAGTCC
CACCGAATTAATTTTCAATCAATAGGTGCCGTGGGCAAACACCCCCTCTCCATGGTATCACCAATTCAGCGCCTT
TCCCAGAGAAGCCCTCATCCACGCCATTGAATACGAAGAATACACCCTCACCGACCGCGGCACCTTTCTCTCTCT
TCCACGTTATCTCCGCAACAGCATCACTGTCTTCAAGGCCGGCACCGACGACGGCAACGACCCTCTCCTCAACGC
CGCTTACTTGTCTGTCGGCACACGGGCGCAAAACGTGTCCTTGGCTAGATTTTTTGGCAGATGGACAATGCATCC
CAATGGCCAGACTGTTATCAAGCACTTTGGAAAGGGTGAAGAACCACTTTATAGCGGTTCCCCCATTCGAACCCT
AGATGAATTGGGGAGGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail