Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6621
Gene name
LocationContig_61:100051..101653
Strand+
Gene length (bp)1602
Transcript length (bp)1602
Coding sequence length (bp)1602
Protein length (aa) 534

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02934 GatB_N GatB/GatE catalytic domain 4.8E-98 11 301
PF02637 GatB_Yqey GatB domain 4.4E-08 373 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YPY3|GATB_NECH7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_39102 PE=3 SV=1 2 531 0.0E+00
sp|C9SFZ6|GATB_VERA1 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03509 PE=3 SV=1 2 530 0.0E+00
sp|Q7S2V0|GATB_NEUCR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09025 PE=3 SV=1 2 533 0.0E+00
sp|B2AL82|GATB_PODAN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_5_9870 PE=3 SV=2 2 533 0.0E+00
sp|A4R713|GATB_MAGO7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_03390 PE=3 SV=1 2 528 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YPY3|GATB_NECH7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_39102 PE=3 SV=1 2 531 0.0E+00
sp|C9SFZ6|GATB_VERA1 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_03509 PE=3 SV=1 2 530 0.0E+00
sp|Q7S2V0|GATB_NEUCR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09025 PE=3 SV=1 2 533 0.0E+00
sp|B2AL82|GATB_PODAN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_5_9870 PE=3 SV=2 2 533 0.0E+00
sp|A4R713|GATB_MAGO7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_03390 PE=3 SV=1 2 528 0.0E+00
sp|Q208S2|GATB_PARBR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Paracoccidioides brasiliensis PE=2 SV=1 8 529 4.0E-172
sp|C1G198|GATB_PARBD Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00638 PE=3 SV=2 8 529 4.0E-172
sp|A1D6S8|GATB_NEOFI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_065860 PE=3 SV=1 8 524 8.0E-171
sp|Q4WY16|GATB_ASPFU Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G11440 PE=3 SV=2 8 524 1.0E-170
sp|B0XXK5|GATB_ASPFC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_037730 PE=3 SV=2 8 524 6.0E-170
sp|Q33446|GATB_EMENI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nempA PE=3 SV=3 8 524 8.0E-170
sp|C1GTX5|GATB_PARBA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_01970 PE=3 SV=2 8 529 1.0E-168
sp|A1CKP5|GATB_ASPCL Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_039340 PE=3 SV=1 8 524 2.0E-168
sp|C6HRN2|GATB_AJECH Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=HCDG_08617 PE=3 SV=2 8 529 2.0E-168
sp|C5G7E1|GATB_AJEDR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00769 PE=3 SV=1 8 529 3.0E-166
sp|C5JUE6|GATB_AJEDS Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_06294 PE=3 SV=1 8 529 4.0E-166
sp|B6H4I3|GATB_PENRW Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc13g09720 PE=3 SV=1 8 524 4.0E-165
sp|C5FS59|GATB_ARTOC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_05531 PE=3 SV=1 2 525 3.0E-164
sp|B8M501|GATB_TALSN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_027330 PE=3 SV=1 8 529 1.0E-160
sp|B6Q348|GATB_TALMQ Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_019330 PE=3 SV=1 7 524 2.0E-159
sp|Q2UKS0|GATB_ASPOR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090003000698 PE=3 SV=1 8 524 1.0E-157
sp|B8N3N5|GATB_ASPFN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_031190 PE=3 SV=1 8 524 1.0E-157
sp|A2QDI9|GATB_ASPNC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g07260 PE=3 SV=1 8 524 7.0E-156
sp|C0NV09|GATB_AJECG Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_06773 PE=3 SV=2 8 529 3.0E-146
sp|Q2GKN0|GATB_ANAPZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaplasma phagocytophilum (strain HZ) GN=gatB PE=3 SV=1 1 529 1.0E-92
sp|Q215W3|GATB_RHOPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain BisB18) GN=gatB PE=3 SV=1 4 527 3.0E-92
sp|B9KI71|GATB_ANAMF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaplasma marginale (strain Florida) GN=gatB PE=3 SV=1 8 527 9.0E-92
sp|Q5PB50|GATB_ANAMM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaplasma marginale (strain St. Maries) GN=gatB PE=3 SV=1 8 527 5.0E-91
sp|A8EXM0|GATB_RICCK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia canadensis (strain McKiel) GN=gatB PE=3 SV=1 4 527 3.0E-90
sp|A5FWV7|GATB_ACICJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Acidiphilium cryptum (strain JF-5) GN=gatB PE=3 SV=1 4 527 7.0E-90
sp|Q68XL7|GATB_RICTY Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=gatB PE=3 SV=1 4 528 1.0E-89
sp|Q89K31|GATB_BRADU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gatB PE=3 SV=1 1 527 2.0E-89
sp|Q9ZE11|GATB_RICPR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia prowazekii (strain Madrid E) GN=gatB PE=3 SV=1 4 528 6.0E-89
sp|A5EKP2|GATB_BRASB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gatB PE=3 SV=1 1 527 9.0E-89
sp|B8GL96|GATB_THISH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gatB PE=3 SV=1 8 528 3.0E-88
sp|A5DWJ3|GATB_LODEL Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PET112 PE=3 SV=1 8 313 1.0E-87
sp|Q4UKF0|GATB_RICFE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gatB PE=3 SV=1 4 528 1.0E-87
sp|Q1RHE8|GATB_RICBR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia bellii (strain RML369-C) GN=gatB PE=3 SV=1 6 527 2.0E-87
sp|Q1QL34|GATB_NITHX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gatB PE=3 SV=1 4 527 3.0E-87
sp|Q3SR35|GATB_NITWN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gatB PE=3 SV=1 4 527 1.0E-86
sp|Q92J76|GATB_RICCN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=gatB PE=3 SV=1 4 527 3.0E-86
sp|C3PMI9|GATB_RICAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia africae (strain ESF-5) GN=gatB PE=3 SV=1 4 527 4.0E-86
sp|A8GV45|GATB_RICB8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia bellii (strain OSU 85-389) GN=gatB PE=3 SV=1 6 527 4.0E-86
sp|B0BWC2|GATB_RICRO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia rickettsii (strain Iowa) GN=gatB PE=3 SV=1 4 527 4.0E-86
sp|A8GQX6|GATB_RICRS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia rickettsii (strain Sheila Smith) GN=gatB PE=3 SV=1 4 527 5.0E-86
sp|Q135J9|GATB_RHOPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain BisB5) GN=gatB PE=3 SV=1 4 527 5.0E-86
sp|B0UHC4|GATB_METS4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium sp. (strain 4-46) GN=gatB PE=3 SV=1 4 527 6.0E-86
sp|C4K0R5|GATB_RICPU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rickettsia peacockii (strain Rustic) GN=gatB PE=3 SV=1 5 527 7.0E-86
sp|P61347|GATB_RHOPA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gatB PE=3 SV=1 4 527 9.0E-86
sp|B8IL55|GATB_METNO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=gatB PE=3 SV=1 4 527 1.0E-85
sp|Q751Q9|GATB_ASHGO Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET112 PE=3 SV=1 8 525 2.0E-85
sp|Q0BTK1|GATB_GRABC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=gatB PE=3 SV=1 1 386 2.0E-85
sp|B1ZIK6|GATB_METPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gatB PE=3 SV=1 8 527 2.0E-85
sp|Q2IXB5|GATB_RHOP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain HaA2) GN=gatB PE=3 SV=1 4 527 3.0E-85
sp|A5CEC9|GATB_ORITB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Orientia tsutsugamushi (strain Boryong) GN=gatB PE=3 SV=1 8 532 5.0E-85
sp|Q07L96|GATB_RHOP5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodopseudomonas palustris (strain BisA53) GN=gatB PE=3 SV=1 4 527 6.0E-85
sp|A8ICV0|GATB_AZOC5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gatB PE=3 SV=1 6 527 1.0E-84
sp|B7KTR5|GATB_METC4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gatB PE=3 SV=1 8 527 1.0E-84
sp|A1USB4|GATB_BARBK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gatB PE=3 SV=1 1 528 2.0E-84
sp|A9VWZ8|GATB_METEP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium extorquens (strain PA1) GN=gatB PE=3 SV=1 8 527 2.0E-84
sp|B6JFW6|GATB_OLICO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gatB PE=3 SV=1 4 527 2.0E-84
sp|Q6FXR9|GATB_CANGA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PET112 PE=3 SV=1 7 524 3.0E-84
sp|A7IMA9|GATB_XANP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gatB PE=3 SV=1 1 527 3.0E-84
sp|C5DE55|GATB_LACTC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=PET112 PE=3 SV=1 3 524 3.0E-84
sp|A5CZ96|GATB_PELTS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=gatB PE=3 SV=1 8 527 4.0E-84
sp|Q87WR8|GATB_PSESM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gatB PE=3 SV=1 8 528 1.0E-83
sp|Q3AD35|GATB_CARHZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gatB PE=3 SV=1 8 530 2.0E-83
sp|B3CQQ8|GATB_ORITI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Orientia tsutsugamushi (strain Ikeda) GN=gatB PE=3 SV=1 8 532 2.0E-83
sp|Q48E91|GATB_PSE14 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gatB PE=3 SV=1 8 528 2.0E-83
sp|Q4ZNS6|GATB_PSEU2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gatB PE=3 SV=1 8 528 4.0E-83
sp|Q9A5L1|GATB_CAUCR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gatB PE=3 SV=1 5 527 8.0E-83
sp|C4R8P2|GATB_PICPG Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PET112 PE=3 SV=1 9 531 1.0E-82
sp|B1LUB2|GATB_METRJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gatB PE=3 SV=1 8 527 1.0E-82
sp|Q67KJ3|GATB_SYMTH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gatB PE=3 SV=1 4 529 2.0E-82
sp|A8LI95|GATB_DINSH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gatB PE=3 SV=1 8 527 3.0E-82
sp|B2IEA3|GATB_BEII9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gatB PE=3 SV=1 6 527 3.0E-82
sp|Q0ACB6|GATB_ALKEH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gatB PE=3 SV=1 8 528 4.0E-82
sp|B8EPC0|GATB_METSB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gatB PE=3 SV=1 4 437 6.0E-82
sp|Q60CK9|GATB_METCA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gatB PE=3 SV=1 8 528 7.0E-82
sp|A5DE65|GATB_PICGU Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PET112 PE=3 SV=2 2 508 8.0E-82
sp|P33893|GATB_YEAST Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET112 PE=1 SV=3 8 524 1.0E-81
sp|C5DQW8|GATB_ZYGRC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=PET112 PE=3 SV=1 8 524 1.0E-81
sp|A6ZKM2|GATB_YEAS7 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=PET112 PE=3 SV=1 8 524 2.0E-81
sp|A4XQK5|GATB_PSEMY Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas mendocina (strain ymp) GN=gatB PE=3 SV=1 8 528 2.0E-81
sp|Q4P525|GATB_USTMA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10688 PE=3 SV=2 7 384 2.0E-81
sp|Q2GG24|GATB_EHRCR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=gatB PE=3 SV=1 8 528 4.0E-81
sp|C8Z3R4|GATB_YEAS8 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=PET112 PE=3 SV=1 8 524 5.0E-81
sp|B5VDR1|GATB_YEAS6 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=PET112 PE=3 SV=1 8 524 5.0E-81
sp|C7GK54|GATB_YEAS2 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=PET112 PE=3 SV=1 8 524 5.0E-81
sp|B3LNL2|GATB_YEAS1 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PET112 PE=3 SV=1 8 524 5.0E-81
sp|Q3KI28|GATB_PSEPF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas fluorescens (strain Pf0-1) GN=gatB PE=3 SV=1 8 528 9.0E-81
sp|Q1IED4|GATB_PSEE4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas entomophila (strain L48) GN=gatB PE=3 SV=1 8 528 9.0E-81
sp|Q4KIA9|GATB_PSEF5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gatB PE=3 SV=1 8 528 1.0E-80
sp|Q2ND71|GATB_ERYLH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Erythrobacter litoralis (strain HTCC2594) GN=gatB PE=3 SV=1 4 527 1.0E-80
sp|Q5KEG8|GATB_CRYNJ Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNG00570 PE=3 SV=1 7 423 2.0E-80
sp|A5VZ21|GATB_PSEP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gatB PE=3 SV=1 8 528 2.0E-80
sp|Q6G3Y7|GATB_BARHE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gatB PE=3 SV=1 1 527 2.0E-80
sp|B6IZ24|GATB_COXB2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain CbuG_Q212) GN=gatB PE=3 SV=1 8 527 2.0E-80
sp|Q5A9Z1|GATB_CANAL Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PET112 PE=3 SV=1 7 336 3.0E-80
sp|B1JDP2|GATB_PSEPW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain W619) GN=gatB PE=3 SV=1 8 528 3.0E-80
sp|Q11HL0|GATB_CHESB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chelativorans sp. (strain BNC1) GN=gatB PE=3 SV=1 4 527 3.0E-80
sp|C4YE90|GATB_CANAW Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida albicans (strain WO-1) GN=PET112 PE=3 SV=1 7 336 3.0E-80
sp|Q8UFS3|GATB_AGRFC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gatB PE=3 SV=2 4 527 3.0E-80
sp|A4XHY9|GATB_CALS8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gatB PE=3 SV=1 8 530 4.0E-80
sp|Q6CMF5|GATB_KLULA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PET112 PE=3 SV=1 8 520 4.0E-80
sp|A7TI41|GATB_VANPO Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PET112 PE=3 SV=1 3 524 5.0E-80
sp|C3K6Y3|GATB_PSEFS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas fluorescens (strain SBW25) GN=gatB PE=3 SV=1 8 528 5.0E-80
sp|Q88PC0|GATB_PSEPK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain KT2440) GN=gatB PE=3 SV=1 8 528 6.0E-80
sp|Q83BM8|GATB_COXBU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gatB PE=3 SV=1 8 527 7.0E-80
sp|Q6BT30|GATB_DEBHA Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PET112 PE=3 SV=2 7 527 9.0E-80
sp|A3PHJ3|GATB_RHOS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gatB PE=3 SV=1 8 437 1.0E-79
sp|A9N8Z5|GATB_COXBR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gatB PE=3 SV=1 8 527 1.0E-79
sp|A9KBI1|GATB_COXBN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gatB PE=3 SV=1 8 527 1.0E-79
sp|B6J4H6|GATB_COXB1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Coxiella burnetii (strain CbuK_Q154) GN=gatB PE=3 SV=1 8 527 1.0E-79
sp|A1AW14|GATB_RUTMC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gatB PE=3 SV=1 8 527 1.0E-79
sp|B0KQF9|GATB_PSEPG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas putida (strain GB-1) GN=gatB PE=3 SV=1 8 528 1.0E-79
sp|B0CXE1|GATB_LACBS Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_231681 PE=3 SV=1 7 334 1.0E-79
sp|B0KBN3|GATB_THEP3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gatB PE=3 SV=1 8 529 1.0E-79
sp|A3GFV6|GATB_PICST Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PET112 PE=3 SV=1 7 438 2.0E-79
sp|C3MAA7|GATB_RHISN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium sp. (strain NGR234) GN=gatB PE=3 SV=1 4 527 2.0E-79
sp|Q3J4Z8|GATB_RHOS4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gatB PE=3 SV=1 8 456 2.0E-79
sp|Q02GV7|GATB_PSEAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gatB PE=3 SV=1 8 528 2.0E-79
sp|A4WX55|GATB_RHOS5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gatB PE=3 SV=1 8 437 2.0E-79
sp|Q1GYD4|GATB_METFK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gatB PE=3 SV=1 8 527 2.0E-79
sp|Q2RGY5|GATB_MOOTA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Moorella thermoacetica (strain ATCC 39073) GN=gatB PE=3 SV=1 8 527 3.0E-79
sp|B0CLM5|GATB_BRUSI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gatB PE=3 SV=1 1 527 3.0E-79
sp|B0K3S4|GATB_THEPX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermoanaerobacter sp. (strain X514) GN=gatB PE=3 SV=1 8 529 3.0E-79
sp|O66766|GATB_AQUAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Aquifex aeolicus (strain VF5) GN=gatB PE=1 SV=1 8 530 4.0E-79
sp|Q9HVT7|GATB_PSEAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gatB PE=1 SV=1 8 528 4.0E-79
sp|B7V024|GATB_PSEA8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain LESB58) GN=gatB PE=3 SV=1 8 528 4.0E-79
sp|B6IPU4|GATB_RHOCS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gatB PE=3 SV=1 6 528 5.0E-79
sp|A6VBJ9|GATB_PSEA7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas aeruginosa (strain PA7) GN=gatB PE=3 SV=1 8 528 5.0E-79
sp|C5MFG4|GATB_CANTT Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=PET112 PE=3 SV=1 8 336 5.0E-79
sp|Q2SBG4|GATB_HAHCH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Hahella chejuensis (strain KCTC 2396) GN=gatB PE=3 SV=1 8 527 6.0E-79
sp|Q2GEW1|GATB_NEOSM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neorickettsia sennetsu (strain Miyayama) GN=gatB PE=3 SV=1 8 531 7.0E-79
sp|A2BZG6|GATB_PROM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain NATL1A) GN=gatB PE=3 SV=1 1 528 8.0E-79
sp|Q46I09|GATB_PROMT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain NATL2A) GN=gatB PE=3 SV=1 1 528 9.0E-79
sp|B0W3H3|GATB_CULQU Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Culex quinquefasciatus GN=CPIJ001717 PE=3 SV=1 8 485 1.0E-78
sp|A1WVR6|GATB_HALHL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gatB PE=3 SV=1 8 528 1.0E-78
sp|B9KMT6|GATB_RHOSK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=gatB PE=3 SV=1 8 456 1.0E-78
sp|B8FJV3|GATB_DESAA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfatibacillum alkenivorans (strain AK-01) GN=gatB PE=3 SV=1 8 529 2.0E-78
sp|Q5NPF4|GATB_ZYMMO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gatB PE=3 SV=2 4 384 2.0E-78
sp|B9MQ85|GATB_CALBD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=gatB PE=3 SV=1 8 530 2.0E-78
sp|Q5FND4|GATB_GLUOX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Gluconobacter oxydans (strain 621H) GN=gatB PE=3 SV=1 1 335 2.0E-78
sp|Q31F54|GATB_THICR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thiomicrospira crunogena (strain XCL-2) GN=gatB PE=3 SV=1 8 528 2.0E-78
sp|Q891I2|GATB_CLOTE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium tetani (strain Massachusetts / E88) GN=gatB PE=3 SV=1 8 530 3.0E-78
sp|D2V9W6|GATB_NAEGR Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_36099 PE=3 SV=1 7 526 3.0E-78
sp|Q2RPH5|GATB_RHORT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gatB PE=3 SV=1 8 527 3.0E-78
sp|A4VIA8|GATB_PSEU5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudomonas stutzeri (strain A1501) GN=gatB PE=3 SV=1 8 528 4.0E-78
sp|P64198|GATB_BRUSU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella suis biovar 1 (strain 1330) GN=gatB PE=3 SV=1 1 527 5.0E-78
sp|P64197|GATB_BRUME Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gatB PE=3 SV=1 1 527 5.0E-78
sp|C0RIN3|GATB_BRUMB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gatB PE=3 SV=1 1 527 5.0E-78
sp|A9MAS2|GATB_BRUC2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gatB PE=3 SV=1 1 527 5.0E-78
sp|Q57DK8|GATB_BRUAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella abortus biovar 1 (strain 9-941) GN=gatB PE=3 SV=1 1 527 5.0E-78
sp|Q2YNL2|GATB_BRUA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella abortus (strain 2308) GN=gatB PE=3 SV=1 1 527 5.0E-78
sp|B2S5D2|GATB_BRUA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella abortus (strain S19) GN=gatB PE=3 SV=1 1 527 5.0E-78
sp|B5YL60|GATB_THEYD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gatB PE=3 SV=1 8 523 5.0E-78
sp|Q5LPK1|GATB_RUEPO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gatB PE=3 SV=1 3 527 6.0E-78
sp|B9W7X4|GATB_CANDC Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=PET112 PE=3 SV=1 7 336 7.0E-78
sp|Q8RC39|GATB_CALS4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gatB PE=3 SV=1 8 529 8.0E-78
sp|A9ISC3|GATB_BART1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gatB PE=3 SV=1 1 527 1.0E-77
sp|A6U821|GATB_SINMW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sinorhizobium medicae (strain WSM419) GN=gatB PE=3 SV=1 4 527 1.0E-77
sp|A6X191|GATB_OCHA4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gatB PE=3 SV=1 1 527 1.0E-77
sp|Q28R79|GATB_JANSC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Jannaschia sp. (strain CCS1) GN=gatB PE=3 SV=1 8 456 1.0E-77
sp|Q3AVV7|GATB_SYNS9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain CC9902) GN=gatB PE=3 SV=1 8 528 2.0E-77
sp|Q1GIT2|GATB_RUEST Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ruegeria sp. (strain TM1040) GN=gatB PE=3 SV=1 8 527 2.0E-77
sp|Q2G4F6|GATB_NOVAD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=gatB PE=3 SV=1 4 527 2.0E-77
sp|Q7U3S3|GATB_SYNPX Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain WH8102) GN=gatB PE=3 SV=1 1 528 2.0E-77
sp|Q163L1|GATB_ROSDO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gatB PE=3 SV=1 8 527 3.0E-77
sp|Q99JT1|GATB_MOUSE Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Mus musculus GN=Gatb PE=1 SV=1 8 487 3.0E-77
sp|B9JVJ7|GATB_AGRVS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gatB PE=3 SV=1 4 527 3.0E-77
sp|A5VQ81|GATB_BRUO2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gatB PE=3 SV=1 1 527 3.0E-77
sp|Q92QK5|GATB_RHIME Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium meliloti (strain 1021) GN=gatB PE=3 SV=2 4 527 3.0E-77
sp|Q0VS73|GATB_ALCBS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gatB PE=3 SV=1 8 528 4.0E-77
sp|Q3YSJ0|GATB_EHRCJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia canis (strain Jake) GN=gatB PE=3 SV=1 8 528 7.0E-77
sp|Q98ND3|GATB_RHILO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium loti (strain MAFF303099) GN=gatB PE=3 SV=1 4 527 1.0E-76
sp|Q3ZW41|GATB_DEHMC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dehalococcoides mccartyi (strain CBDB1) GN=gatB PE=3 SV=1 8 529 1.0E-76
sp|Q49092|GATB_MORCA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Moraxella catarrhalis GN=gatB PE=3 SV=2 5 527 2.0E-76
sp|Q16UG2|GATB_AEDAE Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Aedes aegypti GN=AAEL009908 PE=3 SV=1 8 525 2.0E-76
sp|Q5GRT2|GATB_WOLTR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=gatB PE=3 SV=1 4 456 2.0E-76
sp|Q3APF2|GATB_CHLCH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium chlorochromatii (strain CaD3) GN=gatB PE=3 SV=1 8 528 2.0E-76
sp|B3CN64|GATB_WOLPP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=gatB PE=3 SV=1 4 527 2.0E-76
sp|Q3Z6A1|GATB_DEHM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gatB PE=3 SV=1 8 529 2.0E-76
sp|Q5HBP2|GATB_EHRRW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia ruminantium (strain Welgevonden) GN=gatB PE=3 SV=1 8 529 3.0E-76
sp|Q3AGQ3|GATB_SYNSC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain CC9605) GN=gatB PE=3 SV=1 8 528 3.0E-76
sp|B8I602|GATB_CLOCE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=gatB PE=3 SV=1 11 531 4.0E-76
sp|Q5FHD2|GATB_EHRRG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ehrlichia ruminantium (strain Gardel) GN=gatB PE=3 SV=1 8 529 5.0E-76
sp|Q2YC90|GATB_NITMU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gatB PE=3 SV=1 8 527 5.0E-76
sp|C1DQ36|GATB_AZOVD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=gatB PE=3 SV=1 8 528 5.0E-76
sp|Q6FZK7|GATB_BARQU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bartonella quintana (strain Toulouse) GN=gatB PE=3 SV=1 1 527 8.0E-76
sp|Q21FS7|GATB_SACD2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gatB PE=3 SV=1 8 528 9.0E-76
sp|Q82T56|GATB_NITEU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gatB PE=3 SV=1 8 527 1.0E-75
sp|Q6FDY4|GATB_ACIAD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gatB PE=3 SV=1 2 527 1.0E-75
sp|Q2W6Y7|GATB_MAGSA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gatB PE=3 SV=1 6 527 2.0E-75
sp|Q9UT77|GATB_SCHPO Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC343.13 PE=3 SV=1 4 529 2.0E-75
sp|Q3J9M1|GATB_NITOC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gatB PE=3 SV=1 8 527 2.0E-75
sp|Q31S19|GATB_SYNE7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus elongatus (strain PCC 7942) GN=gatB PE=3 SV=1 8 528 2.0E-75
sp|A2CDJ8|GATB_PROM3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9303) GN=gatB PE=3 SV=1 2 528 3.0E-75
sp|B3PXX8|GATB_RHIE6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium etli (strain CIAT 652) GN=gatB PE=3 SV=1 4 527 3.0E-75
sp|C5BSY9|GATB_TERTT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gatB PE=3 SV=1 8 528 3.0E-75
sp|Q7T010|GATB_DANRE Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Danio rerio GN=gatb PE=3 SV=2 12 460 4.0E-75
sp|B5ZMJ6|GATB_RHILW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gatB PE=3 SV=1 4 527 6.0E-75
sp|A1K1T3|GATB_AZOSB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Azoarcus sp. (strain BH72) GN=gatB PE=3 SV=1 8 527 6.0E-75
sp|Q8DGC4|GATB_THEEB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermosynechococcus elongatus (strain BP-1) GN=gatB PE=3 SV=1 8 527 9.0E-75
sp|Q2K933|GATB_RHIEC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gatB PE=3 SV=1 4 527 1.0E-74
sp|Q1MHI9|GATB_RHIL3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gatB PE=3 SV=1 4 527 1.0E-74
sp|B3PC09|GATB_CELJU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cellvibrio japonicus (strain Ueda107) GN=gatB PE=3 SV=1 8 517 3.0E-74
sp|A5GPE6|GATB_SYNPW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain WH7803) GN=gatB PE=3 SV=1 8 528 3.0E-74
sp|Q5N294|GATB_SYNP6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gatB PE=3 SV=1 8 528 4.0E-74
sp|A0Q8I1|GATB_FRATN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. novicida (strain U112) GN=gatB PE=3 SV=1 7 529 5.0E-74
sp|A3CLF9|GATB_STRSV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus sanguinis (strain SK36) GN=gatB PE=3 SV=1 8 530 7.0E-74
sp|Q5P4D1|GATB_AROAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Aromatoleum aromaticum (strain EbN1) GN=gatB PE=3 SV=1 8 528 7.0E-74
sp|Q7W3H6|GATB_BORPA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gatB PE=3 SV=1 8 527 9.0E-74
sp|A9I0H0|GATB_BORPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gatB PE=3 SV=1 8 528 1.0E-73
sp|A5V3U9|GATB_SPHWW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gatB PE=3 SV=1 4 333 1.0E-73
sp|P61343|GATB_GEOSL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gatB PE=3 SV=1 8 528 1.0E-73
sp|Q7WEV0|GATB_BORBR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gatB PE=3 SV=1 8 527 2.0E-73
sp|Q7TUK1|GATB_PROMM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9313) GN=gatB PE=3 SV=1 2 528 3.0E-73
sp|C0R5B9|GATB_WOLWR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=gatB PE=3 SV=1 8 527 4.0E-73
sp|P61349|GATB_WOLPM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Wolbachia pipientis wMel GN=gatB PE=3 SV=1 8 527 5.0E-73
sp|Q39BW4|GATB_BURL3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gatB PE=3 SV=1 8 527 8.0E-73
sp|Q7VSN3|GATB_BORPE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gatB PE=3 SV=1 8 527 9.0E-73
sp|A5ICP3|GATB_LEGPC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila (strain Corby) GN=gatB PE=3 SV=1 8 527 1.0E-72
sp|B6JYB6|GATB_SCHJY Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_01577 PE=3 SV=1 4 527 1.0E-72
sp|A8AVE3|GATB_STRGC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=gatB PE=3 SV=1 8 530 1.0E-72
sp|Q9X100|GATB_THEMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gatB PE=1 SV=1 12 528 2.0E-72
sp|B3EHE8|GATB_CHLL2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gatB PE=3 SV=1 8 528 2.0E-72
sp|B2UZ27|GATB_CLOBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gatB PE=3 SV=1 8 529 2.0E-72
sp|O75879|GATB_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Homo sapiens GN=GATB PE=1 SV=1 8 350 3.0E-72
sp|Q55ER8|GATB_DICDI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0268776 PE=3 SV=1 8 334 3.0E-72
sp|P61341|GATB_BDEBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gatB PE=3 SV=1 7 531 4.0E-72
sp|A9B5C4|GATB_HERA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gatB PE=3 SV=1 8 528 4.0E-72
sp|B2SEM7|GATB_FRATM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gatB PE=3 SV=1 7 529 5.0E-72
sp|B2U7W0|GATB_RALPJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ralstonia pickettii (strain 12J) GN=gatB PE=3 SV=1 8 527 5.0E-72
sp|A0KBH8|GATB_BURCH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain HI2424) GN=gatB PE=3 SV=1 8 527 6.0E-72
sp|B1K0H6|GATB_BURCC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain MC0-3) GN=gatB PE=3 SV=1 8 527 6.0E-72
sp|Q1BSL3|GATB_BURCA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain AU 1054) GN=gatB PE=3 SV=1 8 527 6.0E-72
sp|A4IVY4|GATB_FRATW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gatB PE=3 SV=1 7 529 7.0E-72
sp|Q5NIP5|GATB_FRATT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gatB PE=3 SV=1 7 529 7.0E-72
sp|Q0BK41|GATB_FRATO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gatB PE=3 SV=1 7 529 7.0E-72
sp|Q2A1D9|GATB_FRATH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gatB PE=3 SV=2 7 529 7.0E-72
sp|A7NEM0|GATB_FRATF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gatB PE=3 SV=2 7 529 7.0E-72
sp|Q14K48|GATB_FRAT1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gatB PE=3 SV=1 7 529 7.0E-72
sp|C3KU96|GATB_CLOB6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gatB PE=3 SV=1 8 530 7.0E-72
sp|B2TJ00|GATB_CLOBB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gatB PE=3 SV=1 8 529 7.0E-72
sp|Q0AFP3|GATB_NITEC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nitrosomonas eutropha (strain C91) GN=gatB PE=3 SV=1 8 527 8.0E-72
sp|Q6C6I6|GATB_YARLI Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PET112 PE=3 SV=1 9 530 1.0E-71
sp|Q2JXB3|GATB_SYNJA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain JA-3-3Ab) GN=gatB PE=3 SV=1 8 528 1.0E-71
sp|Q2JNH3|GATB_SYNJB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gatB PE=3 SV=1 8 528 1.0E-71
sp|Q3A2J9|GATB_PELCD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gatB PE=3 SV=1 8 527 2.0E-71
sp|Q3B6H8|GATB_CHLL7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gatB PE=3 SV=1 8 528 2.0E-71
sp|C4Z3J5|GATB_EUBE2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=gatB PE=3 SV=1 8 456 2.0E-71
sp|C5CY39|GATB_VARPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Variovorax paradoxus (strain S110) GN=gatB PE=3 SV=1 7 527 3.0E-71
sp|A5N2W5|GATB_CLOK5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gatB PE=3 SV=1 8 529 3.0E-71
sp|B9DWL7|GATB_CLOK1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium kluyveri (strain NBRC 12016) GN=gatB PE=3 SV=1 8 529 3.0E-71
sp|A2RHP6|GATB_LACLM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gatB PE=3 SV=1 8 530 3.0E-71
sp|B2JJW3|GATB_BURP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gatB PE=3 SV=1 8 527 3.0E-71
sp|Q5WVV9|GATB_LEGPL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila (strain Lens) GN=gatB PE=3 SV=1 8 527 4.0E-71
sp|Q21RH8|GATB_RHOFT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gatB PE=3 SV=2 7 528 4.0E-71
sp|A9M005|GATB_NEIM0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria meningitidis serogroup C (strain 053442) GN=gatB PE=3 SV=1 8 527 5.0E-71
sp|Q032T2|GATB_LACLS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gatB PE=3 SV=1 8 530 5.0E-71
sp|Q5ZUQ6|GATB_LEGPH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gatB PE=3 SV=1 8 527 5.0E-71
sp|B1LC74|GATB_THESQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga sp. (strain RQ2) GN=gatB PE=3 SV=1 12 528 6.0E-71
sp|B9K942|GATB_THENN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gatB PE=3 SV=1 12 528 6.0E-71
sp|Q7VEG1|GATB_PROMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gatB PE=3 SV=1 1 528 7.0E-71
sp|B3QTR8|GATB_CHLT3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gatB PE=3 SV=1 7 528 8.0E-71
sp|A5IMT3|GATB_THEP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gatB PE=3 SV=1 12 528 8.0E-71
sp|Q146Y4|GATB_BURXL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia xenovorans (strain LB400) GN=gatB PE=3 SV=1 8 527 1.0E-70
sp|A5I6Z2|GATB_CLOBH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gatB PE=3 SV=1 8 530 1.0E-70
sp|A7FYL2|GATB_CLOB1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gatB PE=3 SV=1 8 530 1.0E-70
sp|A9KJ27|GATB_CLOPH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gatB PE=3 SV=1 8 529 1.0E-70
sp|D0N761|GATB_PHYIT Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Phytophthora infestans (strain T30-4) GN=PITG_07062 PE=3 SV=1 8 529 1.0E-70
sp|B5ED20|GATB_GEOBB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gatB PE=3 SV=1 8 527 1.0E-70
sp|A5EW27|GATB_DICNV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dichelobacter nodosus (strain VCS1703A) GN=gatB PE=3 SV=1 8 523 2.0E-70
sp|Q5X4H4|GATB_LEGPA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Legionella pneumophila (strain Paris) GN=gatB PE=3 SV=1 8 527 2.0E-70
sp|B1XKN8|GATB_SYNP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gatB PE=3 SV=1 8 531 2.0E-70
sp|Q7NPY8|GATB_CHRVO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gatB PE=3 SV=1 8 527 2.0E-70
sp|B2T1M5|GATB_BURPP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gatB PE=3 SV=1 8 527 2.0E-70
sp|B1X4D6|GATB_PAUCH Glutamyl-tRNA(Gln) amidotransferase subunit B, organellar chromatophore OS=Paulinella chromatophora GN=PCC_0364 PE=3 SV=1 7 523 2.0E-70
sp|C4XIR3|GATB_DESMR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=gatB PE=3 SV=1 8 527 3.0E-70
sp|Q8Y3C6|GATB_RALSO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Ralstonia solanacearum (strain GMI1000) GN=gatB PE=3 SV=1 8 527 3.0E-70
sp|B1YPV7|GATB_BURA4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia ambifaria (strain MC40-6) GN=gatB PE=3 SV=1 8 527 3.0E-70
sp|Q0BAV5|GATB_BURCM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gatB PE=3 SV=1 8 527 3.0E-70
sp|B0BZQ6|GATB_ACAM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Acaryochloris marina (strain MBIC 11017) GN=gatB PE=3 SV=1 8 528 3.0E-70
sp|Q1QDJ5|GATB_PSYCK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Psychrobacter cryohalolentis (strain K5) GN=gatB PE=3 SV=1 5 524 4.0E-70
sp|Q2IH95|GATB_ANADE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gatB PE=3 SV=1 8 527 4.0E-70
sp|Q2T292|GATB_BURTA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=gatB PE=3 SV=1 8 527 4.0E-70
sp|A1V775|GATB_BURMS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain SAVP1) GN=gatB PE=3 SV=1 8 527 5.0E-70
sp|Q62MR3|GATB_BURMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain ATCC 23344) GN=gatB PE=3 SV=1 8 527 5.0E-70
sp|A2S8J0|GATB_BURM9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain NCTC 10229) GN=gatB PE=3 SV=1 8 527 5.0E-70
sp|A3MNR7|GATB_BURM7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia mallei (strain NCTC 10247) GN=gatB PE=3 SV=1 8 527 5.0E-70
sp|Q2KU71|GATB_BORA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bordetella avium (strain 197N) GN=gatB PE=3 SV=1 8 527 5.0E-70
sp|Q9CJ41|GATB_LACLA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gatB PE=3 SV=2 8 530 5.0E-70
sp|Q9JYZ7|GATB_NEIMB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria meningitidis serogroup B (strain MC58) GN=gatB PE=3 SV=1 8 527 5.0E-70
sp|B1INF6|GATB_CLOBK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Okra / Type B1) GN=gatB PE=3 SV=1 8 335 5.0E-70
sp|Q39ZK2|GATB_GEOMG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gatB PE=3 SV=1 8 528 8.0E-70
sp|C6E6Z3|GATB_GEOSM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter sp. (strain M21) GN=gatB PE=3 SV=1 8 528 9.0E-70
sp|A8F5H5|GATB_PSELT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gatB PE=3 SV=1 7 524 9.0E-70
sp|Q8DSG6|GATB_STRMU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=gatB PE=3 SV=1 8 530 1.0E-69
sp|A5CX66|GATB_VESOH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gatB PE=3 SV=1 8 527 1.0E-69
sp|Q8ES77|GATB_OCEIH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gatB PE=3 SV=1 7 333 1.0E-69
sp|A5G9J8|GATB_GEOUR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter uraniireducens (strain Rf4) GN=gatB PE=3 SV=1 8 527 1.0E-69
sp|Q97FQ8|GATB1_CLOAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatB1 PE=3 SV=1 8 529 1.0E-69
sp|Q63YJ8|GATB_BURPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain K96243) GN=gatB PE=3 SV=1 8 527 2.0E-69
sp|A3N4F5|GATB_BURP6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain 668) GN=gatB PE=3 SV=1 8 527 2.0E-69
sp|Q3JXC0|GATB_BURP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain 1710b) GN=gatB PE=3 SV=1 8 527 2.0E-69
sp|A3NQ46|GATB_BURP0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia pseudomallei (strain 1106a) GN=gatB PE=3 SV=1 8 527 2.0E-69
sp|Q31DD5|GATB_PROM9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9312) GN=gatB PE=3 SV=1 8 527 2.0E-69
sp|B1L1G8|GATB_CLOBM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gatB PE=3 SV=1 8 335 2.0E-69
sp|Q3SM40|GATB_THIDA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gatB PE=3 SV=1 8 528 3.0E-69
sp|C0Z4E5|GATB_BREBN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=gatB PE=3 SV=1 8 335 3.0E-69
sp|C1FLD8|GATB_CLOBJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gatB PE=3 SV=1 8 530 3.0E-69
sp|A7GIK1|GATB_CLOBL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gatB PE=3 SV=1 8 530 5.0E-69
sp|Q2S1B9|GATB_SALRD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gatB PE=3 SV=1 8 531 6.0E-69
sp|Q9JTZ3|GATB_NEIMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gatB PE=3 SV=1 8 527 6.0E-69
sp|B7K293|GATB_CYAP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cyanothece sp. (strain PCC 8801) GN=gatB PE=3 SV=1 8 528 6.0E-69
sp|A1ATL4|GATB_PELPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelobacter propionicus (strain DSM 2379) GN=gatB PE=3 SV=1 8 531 9.0E-69
sp|B4UIV0|GATB_ANASK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaeromyxobacter sp. (strain K) GN=gatB PE=3 SV=1 8 527 1.0E-68
sp|B4SBR1|GATB_PELPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gatB PE=3 SV=1 8 369 1.0E-68
sp|A1VCY2|GATB_DESVV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gatB PE=3 SV=1 5 527 2.0E-68
sp|Q72AV5|GATB_DESVH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gatB PE=3 SV=1 5 527 2.0E-68
sp|Q6AQD0|GATB_DESPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=gatB PE=3 SV=2 8 529 2.0E-68
sp|A1U487|GATB_MARHV Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gatB PE=3 SV=1 8 510 2.0E-68
sp|A6VWM9|GATB_MARMS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Marinomonas sp. (strain MWYL1) GN=gatB PE=3 SV=1 8 453 2.0E-68
sp|A2BU03|GATB_PROM5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain MIT 9515) GN=gatB PE=3 SV=1 8 527 2.0E-68
sp|B3EP77|GATB_CHLPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium phaeobacteroides (strain BS1) GN=gatB PE=3 SV=1 8 369 2.0E-68
sp|Q8KAE8|GATB_CHLTE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gatB PE=3 SV=1 8 525 2.0E-68
sp|A4T0G5|GATB_POLSQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=gatB PE=3 SV=1 8 527 2.0E-68
sp|A1KUI0|GATB_NEIMF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gatB PE=3 SV=1 8 527 3.0E-68
sp|A4VT84|GATB_STRSY Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus suis (strain 05ZYH33) GN=gatB PE=3 SV=1 8 369 3.0E-68
sp|A4VZG6|GATB_STRS2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus suis (strain 98HAH33) GN=gatB PE=3 SV=1 8 369 3.0E-68
sp|C0ME96|GATB_STRS7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=gatB PE=3 SV=1 8 530 3.0E-68
sp|Q7V3M7|GATB_PROMP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gatB PE=3 SV=1 8 527 3.0E-68
sp|Q8R680|GATB_FUSNN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gatB PE=3 SV=1 5 531 3.0E-68
sp|C0QUH9|GATB_PERMH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=gatB PE=3 SV=1 8 387 4.0E-68
sp|Q8YX22|GATB_NOSS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gatB PE=3 SV=1 8 527 4.0E-68
sp|B4U198|GATB_STREM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=gatB PE=3 SV=1 8 530 5.0E-68
sp|B3QRD6|GATB_CHLP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobaculum parvum (strain NCIB 8327) GN=gatB PE=3 SV=1 8 369 6.0E-68
sp|B4S5P3|GATB_PROA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gatB PE=3 SV=1 8 369 7.0E-68
sp|B2J8F0|GATB_NOSP7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gatB PE=3 SV=1 8 527 7.0E-68
sp|B3EA25|GATB_GEOLS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gatB PE=3 SV=1 8 437 1.0E-67
sp|Q9VCD0|GATB_DROME Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Drosophila melanogaster GN=CG5463 PE=3 SV=2 8 533 1.0E-67
sp|B7H4W3|GATB_BACC4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain B4264) GN=gatB PE=3 SV=1 9 335 1.0E-67
sp|B4RM87|GATB_NEIG2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gatB PE=3 SV=1 8 527 2.0E-67
sp|Q5F8V0|GATB_NEIG1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gatB PE=3 SV=1 8 527 2.0E-67
sp|B1HTX0|GATB_LYSSC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lysinibacillus sphaericus (strain C3-41) GN=gatB PE=3 SV=1 8 335 2.0E-67
sp|Q2LXN0|GATB2_SYNAS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 2 OS=Syntrophus aciditrophicus (strain SB) GN=gatB2 PE=3 SV=1 8 524 2.0E-67
sp|B4E7X7|GATB_BURCJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gatB PE=3 SV=1 8 527 2.0E-67
sp|A7GKK4|GATB_BACCN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gatB PE=3 SV=1 8 335 3.0E-67
sp|A9AC50|GATB_BURM1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gatB PE=3 SV=1 8 527 4.0E-67
sp|A0RP16|GATB_CAMFF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=gatB PE=3 SV=1 8 527 4.0E-67
sp|B7HSY1|GATB_BACC7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain AH187) GN=gatB PE=3 SV=1 9 335 4.0E-67
sp|Q73EK7|GATB_BACC1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gatB PE=3 SV=1 9 335 4.0E-67
sp|Q30Y35|GATB_DESAG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio alaskensis (strain G20) GN=gatB PE=3 SV=1 8 333 4.0E-67
sp|A4JIS9|GATB_BURVG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gatB PE=3 SV=1 8 527 4.0E-67
sp|Q2R2Z0|GATB_ORYSJ Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=GATB PE=2 SV=1 3 528 5.0E-67
sp|B9LZ19|GATB_GEODF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=gatB PE=3 SV=1 8 528 5.0E-67
sp|B7IHR3|GATB_THEAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermosipho africanus (strain TCF52B) GN=gatB PE=3 SV=1 12 523 5.0E-67
sp|C5Y3V8|GATB_SORBI Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Sorghum bicolor GN=GATB PE=3 SV=1 3 527 6.0E-67
sp|Q63GQ9|GATB_BACCZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain ZK / E33L) GN=gatB PE=3 SV=1 9 335 6.0E-67
sp|Q81IN2|GATB_BACCR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gatB PE=3 SV=1 9 335 6.0E-67
sp|B9J1N1|GATB_BACCQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain Q1) GN=gatB PE=3 SV=1 9 335 6.0E-67
sp|B7IUY0|GATB_BACC2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain G9842) GN=gatB PE=3 SV=1 9 335 7.0E-67
sp|C4ZHC0|GATB_EUBR3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=gatB PE=3 SV=1 7 333 7.0E-67
sp|Q97EX9|GATB2_CLOAB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gatB2 PE=3 SV=1 7 523 8.0E-67
sp|Q4FLQ8|GATB_PELUB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Pelagibacter ubique (strain HTCC1062) GN=gatB PE=3 SV=1 8 528 2.0E-66
sp|Q5L3B2|GATB_GEOKA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacillus kaustophilus (strain HTA426) GN=gatB PE=3 SV=1 8 335 2.0E-66
sp|Q4FUG5|GATB_PSYA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gatB PE=3 SV=1 5 524 2.0E-66
sp|Q5XAC8|GATB_STRP6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gatB PE=3 SV=1 8 333 2.0E-66
sp|B8DKV6|GATB_DESVM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=gatB PE=3 SV=1 8 527 3.0E-66
sp|Q1JKC8|GATB_STRPC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=gatB PE=3 SV=1 8 333 3.0E-66
sp|Q1JA75|GATB_STRPB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=gatB PE=3 SV=1 8 333 3.0E-66
sp|C0M7E9|GATB_STRE4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus equi subsp. equi (strain 4047) GN=gatB PE=3 SV=1 8 333 3.0E-66
sp|Q055U6|GATB_LEPBL Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gatB PE=3 SV=1 8 530 3.0E-66
sp|Q72VS5|GATB_LEPIC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gatB PE=3 SV=1 8 530 3.0E-66
sp|B2KE80|GATB_ELUMP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Elusimicrobium minutum (strain Pei191) GN=gatB PE=3 SV=1 8 516 4.0E-66
sp|A4IJZ3|GATB_GEOTN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gatB PE=3 SV=1 8 335 5.0E-66
sp|A9VRH8|GATB_BACWK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus weihenstephanensis (strain KBAB4) GN=gatB PE=3 SV=1 9 335 5.0E-66
sp|O28164|GATB_ARCFU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatB PE=3 SV=2 9 523 5.0E-66
sp|A0Q2P9|GATB_CLONN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium novyi (strain NT) GN=gatB PE=3 SV=1 7 523 5.0E-66
sp|Q5WJ19|GATB_BACSK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus clausii (strain KSM-K16) GN=gatB PE=3 SV=1 8 529 5.0E-66
sp|B1WYK7|GATB_CYAA5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cyanothece sp. (strain ATCC 51142) GN=gatB PE=3 SV=1 8 523 5.0E-66
sp|Q8F9D9|GATB_LEPIN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gatB PE=3 SV=1 8 530 5.0E-66
sp|A9TWD9|GATB_PHYPA Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Physcomitrella patens subsp. patens GN=GATB PE=3 SV=1 4 527 6.0E-66
sp|B7KGN0|GATB_CYAP7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cyanothece sp. (strain PCC 7424) GN=gatB PE=3 SV=1 8 528 6.0E-66
sp|A2RCV8|GATB_STRPG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=gatB PE=3 SV=1 8 531 6.0E-66
sp|Q04PH9|GATB_LEPBJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gatB PE=3 SV=1 8 530 6.0E-66
sp|Q48RQ5|GATB_STRPM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=gatB PE=3 SV=1 8 531 6.0E-66
sp|A1BJ58|GATB_CHLPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gatB PE=3 SV=1 8 386 7.0E-66
sp|A8FAS1|GATB_BACP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus pumilus (strain SAFR-032) GN=gatB PE=3 SV=1 8 529 9.0E-66
sp|A2ZF53|GATB_ORYSI Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Oryza sativa subsp. indica GN=GATB PE=3 SV=1 3 528 9.0E-66
sp|C1D5M8|GATB_LARHH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Laribacter hongkongensis (strain HLHK9) GN=gatB PE=3 SV=1 8 527 9.0E-66
sp|Q93LE1|GATB_GEOSE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Geobacillus stearothermophilus GN=gatB PE=3 SV=1 8 335 1.0E-65
sp|C1EV89|GATB_BACC3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain 03BB102) GN=gatB PE=3 SV=1 9 335 1.0E-65
sp|B7JMB3|GATB_BACC0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus cereus (strain AH820) GN=gatB PE=3 SV=1 9 335 1.0E-65
sp|Q81ZE7|GATB_BACAN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus anthracis GN=gatB PE=3 SV=1 9 335 1.0E-65
sp|A0R922|GATB_BACAH Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus thuringiensis (strain Al Hakam) GN=gatB PE=3 SV=1 9 335 1.0E-65
sp|C3L560|GATB_BACAC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gatB PE=3 SV=1 9 335 1.0E-65
sp|C3PBQ5|GATB_BACAA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus anthracis (strain A0248) GN=gatB PE=3 SV=1 9 335 1.0E-65
sp|A7Z268|GATB_BACMF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gatB PE=3 SV=1 8 529 1.0E-65
sp|Q6HP80|GATB_BACHK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gatB PE=3 SV=1 9 335 1.0E-65
sp|Q8DY26|GATB_STRA5 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=gatB PE=3 SV=1 8 531 1.0E-65
sp|Q3JZM2|GATB_STRA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=gatB PE=3 SV=1 8 531 1.0E-65
sp|Q8NZM1|GATB_STRP8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gatB PE=3 SV=1 8 333 1.0E-65
sp|Q8E3P5|GATB_STRA3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gatB PE=3 SV=1 8 531 1.0E-65
sp|Q3M629|GATB_ANAVT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gatB PE=3 SV=1 8 527 1.0E-65
sp|Q1J570|GATB_STRPF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=gatB PE=3 SV=1 8 531 2.0E-65
sp|Q99YC1|GATB_STRP1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M1 GN=gatB PE=3 SV=1 8 333 2.0E-65
sp|C4Y459|GATB_CLAL4 Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=PET112 PE=3 SV=1 1 527 2.0E-65
sp|Q00YU3|GATB_OSTTA Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Ostreococcus tauri GN=GATB PE=3 SV=1 8 523 3.0E-65
sp|Q65MP7|GATB_BACLD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gatB PE=3 SV=1 8 529 4.0E-65
sp|B9DVG5|GATB_STRU0 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=gatB PE=3 SV=1 8 333 4.0E-65
sp|B9E825|GATB_MACCJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Macrococcus caseolyticus (strain JCSC5402) GN=gatB PE=3 SV=1 8 529 4.0E-65
sp|P0DB27|GATB_STRPQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gatB PE=3 SV=1 8 333 4.0E-65
sp|Q1JFC0|GATB_STRPD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=gatB PE=3 SV=1 8 333 4.0E-65
sp|P0DB26|GATB_STRP3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gatB PE=3 SV=1 8 333 4.0E-65
sp|C1B2L3|GATB_RHOOB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodococcus opacus (strain B4) GN=gatB PE=3 SV=1 3 523 5.0E-65
sp|C1CPU6|GATB_STRZT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=gatB PE=3 SV=1 8 369 5.0E-65
sp|C1CIT7|GATB_STRZP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain P1031) GN=gatB PE=3 SV=1 8 369 5.0E-65
sp|C1CCJ9|GATB_STRZJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain JJA) GN=gatB PE=3 SV=1 8 369 5.0E-65
sp|Q97SE7|GATB_STRPN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=gatB PE=1 SV=1 8 369 5.0E-65
sp|B1I9M7|GATB_STRPI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=gatB PE=3 SV=1 8 369 6.0E-65
sp|Q8DR11|GATB_STRR6 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=gatB PE=3 SV=1 8 369 6.0E-65
sp|Q04M42|GATB_STRP2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=gatB PE=3 SV=1 8 369 6.0E-65
sp|Q837V2|GATB_ENTFA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gatB PE=3 SV=1 8 529 7.0E-65
sp|B9SQR9|GATB_RICCO Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Ricinus communis GN=GATB PE=3 SV=1 8 527 7.0E-65
sp|B5E1P6|GATB_STRP4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=gatB PE=3 SV=1 8 400 8.0E-65
sp|B1GZD2|GATB_UNCTG Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gatB PE=3 SV=1 8 531 8.0E-65
sp|B5XHZ8|GATB_STRPZ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=gatB PE=3 SV=1 8 333 8.0E-65
sp|B8ZLK0|GATB_STRPJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=gatB PE=3 SV=1 8 369 8.0E-65
sp|C1C5H1|GATB_STRP7 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain 70585) GN=gatB PE=3 SV=1 8 369 9.0E-65
sp|B8JBQ0|GATB_ANAD2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gatB PE=3 SV=1 8 527 1.0E-64
sp|B9KZK4|GATB_THERP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=gatB PE=3 SV=1 8 529 1.0E-64
sp|P74215|GATB_SYNY3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gatB PE=3 SV=2 8 523 1.0E-64
sp|A6LLK6|GATB_THEM4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gatB PE=3 SV=1 12 333 1.0E-64
sp|B2ILX7|GATB_STRPS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus pneumoniae (strain CGSP14) GN=gatB PE=3 SV=1 8 369 1.0E-64
sp|A7HIG8|GATB_ANADF Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Anaeromyxobacter sp. (strain Fw109-5) GN=gatB PE=3 SV=1 5 334 2.0E-64
sp|O30509|GATB_BACSU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus subtilis (strain 168) GN=gatB PE=1 SV=2 8 529 2.0E-64
sp|A2BNH6|GATB_PROMS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Prochlorococcus marinus (strain AS9601) GN=gatB PE=3 SV=1 8 527 3.0E-64
sp|Q0S2I1|GATB_RHOJR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodococcus jostii (strain RHA1) GN=gatB PE=3 SV=1 8 523 3.0E-64
sp|B0SNZ7|GATB_LEPBP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gatB PE=3 SV=1 8 350 6.0E-64
sp|B0SFE8|GATB_LEPBA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gatB PE=3 SV=1 8 350 6.0E-64
sp|C1FJ20|GATB2_MICSR Glutamyl-tRNA(Gln) amidotransferase subunit B-2, chloroplastic/mitochondrial OS=Micromonas sp. (strain RCC299 / NOUM17) GN=GATB-2 PE=3 SV=1 8 384 6.0E-64
sp|Q47JV2|GATB_DECAR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Dechloromonas aromatica (strain RCB) GN=gatB PE=3 SV=1 8 527 6.0E-64
sp|Q10XY9|GATB_TRIEI Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Trichodesmium erythraeum (strain IMS101) GN=gatB PE=3 SV=1 8 528 8.0E-64
sp|Q5M313|GATB_STRT2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=gatB PE=3 SV=1 8 333 8.0E-64
sp|Q5LYF0|GATB_STRT1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus thermophilus (strain CNRZ 1066) GN=gatB PE=3 SV=1 8 333 8.0E-64
sp|Q03J82|GATB_STRTD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=gatB PE=3 SV=1 8 333 9.0E-64
sp|Q4L7L3|GATB_STAHJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gatB PE=3 SV=1 8 529 1.0E-63
sp|Q9Z9X0|GATB_BACHD Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gatB PE=3 SV=1 8 529 1.0E-63
sp|Q30QX0|GATB_SULDN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=gatB PE=3 SV=1 8 527 2.0E-63
sp|Q5YRV4|GATB_NOCFA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Nocardia farcinica (strain IFM 10152) GN=gatB PE=3 SV=1 2 326 2.0E-63
sp|A4G1L3|GATB_HERAR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Herminiimonas arsenicoxydans GN=gatB PE=3 SV=1 8 527 2.0E-63
sp|P61344|GATB_LACJO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gatB PE=3 SV=1 7 334 4.0E-63
sp|Q8CRU4|GATB_STAES Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gatB PE=3 SV=1 8 335 5.0E-63
sp|Q5HN35|GATB_STAEQ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gatB PE=3 SV=1 8 335 5.0E-63
sp|Q1WSI0|GATB_LACS1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus salivarius (strain UCC118) GN=gatB PE=3 SV=1 8 437 5.0E-63
sp|C0ZXL3|GATB_RHOE4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=gatB PE=3 SV=1 8 456 6.0E-63
sp|C0R214|GATB_BRAHW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=gatB PE=3 SV=1 8 524 7.0E-63
sp|O33107|GATB_MYCLE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium leprae (strain TN) GN=gatB PE=3 SV=1 5 326 8.0E-63
sp|B8ZS22|GATB_MYCLB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium leprae (strain Br4923) GN=gatB PE=3 SV=1 5 326 8.0E-63
sp|P9WN61|GATB_MYCTU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gatB PE=1 SV=1 3 326 9.0E-63
sp|P9WN60|GATB_MYCTO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gatB PE=3 SV=1 3 326 9.0E-63
sp|A5U721|GATB_MYCTA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gatB PE=3 SV=1 3 326 9.0E-63
sp|C1AGC5|GATB_MYCBT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=gatB PE=3 SV=1 3 326 9.0E-63
sp|A1KN04|GATB_MYCBP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gatB PE=3 SV=1 3 326 9.0E-63
sp|P64200|GATB_MYCBO Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gatB PE=3 SV=1 3 326 9.0E-63
sp|A6LVB6|GATB_CLOB8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=gatB PE=3 SV=1 7 530 9.0E-63
sp|A7I1W4|GATB_CAMHC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=gatB PE=3 SV=1 8 527 9.0E-63
sp|Q041K6|GATB_LACGA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gatB PE=3 SV=1 7 334 9.0E-63
sp|Q2J6U8|GATB_FRASC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Frankia sp. (strain CcI3) GN=gatB PE=3 SV=1 2 329 1.0E-62
sp|Q9Z9G6|GATB_CHLPN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Chlamydia pneumoniae GN=gatB PE=3 SV=1 1 529 1.0E-62
sp|A0QUX1|GATB_MYCS2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gatB PE=3 SV=1 5 465 1.0E-62
sp|Q5FLL0|GATB_LACAC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gatB PE=3 SV=1 7 334 1.0E-62
sp|Q1MPL6|GATB_LAWIP Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=gatB PE=3 SV=1 8 333 2.0E-62
sp|Q04BV6|GATB_LACDB Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=gatB PE=3 SV=1 11 334 2.0E-62
sp|Q1GBF3|GATB_LACDA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gatB PE=3 SV=1 11 334 2.0E-62
sp|Q9RF06|GATB_STAAU Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus GN=gatB PE=1 SV=1 8 335 2.0E-62
sp|Q6GFF8|GATB_STAAR Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain MRSA252) GN=gatB PE=3 SV=1 8 335 2.0E-62
sp|A6SUD6|GATB_JANMA Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Janthinobacterium sp. (strain Marseille) GN=gatB PE=3 SV=1 8 350 3.0E-62
sp|A8YTZ7|GATB_LACH4 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Lactobacillus helveticus (strain DPC 4571) GN=gatB PE=3 SV=1 7 334 4.0E-62
sp|Q1LSE4|GATB_CUPMC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gatB PE=3 SV=1 8 527 5.0E-62
sp|Q1BAT1|GATB_MYCSS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium sp. (strain MCS) GN=gatB PE=3 SV=1 5 465 5.0E-62
sp|A1UE81|GATB_MYCSK Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium sp. (strain KMS) GN=gatB PE=3 SV=1 5 465 5.0E-62
sp|Q9FV81|GATB_ARATH Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=GATB PE=2 SV=1 8 530 6.0E-62
sp|A3PXN5|GATB_MYCSJ Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Mycobacterium sp. (strain JLS) GN=gatB PE=3 SV=1 5 465 7.0E-62
sp|B0RZW3|GATB_FINM2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Finegoldia magna (strain ATCC 29328) GN=gatB PE=3 SV=1 12 527 7.0E-62
sp|P64202|GATB_STAAW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain MW2) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|A8Z2R3|GATB_STAAT Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|Q6G834|GATB_STAAS Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain MSSA476) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|P99169|GATB_STAAN Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain N315) GN=gatB PE=1 SV=1 8 335 7.0E-62
sp|P64201|GATB_STAAM Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gatB PE=1 SV=1 8 335 7.0E-62
sp|A6QIC7|GATB_STAAE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain Newman) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|Q5HEM3|GATB_STAAC Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain COL) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|A5IU66|GATB_STAA9 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain JH9) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|Q2FWZ0|GATB_STAA8 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain NCTC 8325) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|Q2FFJ6|GATB_STAA3 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain USA300) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|A6U304|GATB_STAA2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain JH1) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|A7X426|GATB_STAA1 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gatB PE=3 SV=1 8 335 7.0E-62
sp|Q6MDF6|GATB_PARUW Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B OS=Protochlamydia amoebophila (strain UWE25) GN=gatB PE=3 SV=1 8 530 8.0E-62
[Show less]

GO

GO Term Description Terminal node
GO:0016884 carbon-nitrogen ligase activity, with glutamine as amido-N-donor Yes
GO:0016874 ligase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3398
Ophiocordyceps australis map64 (Brazil) OphauB2|6621 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05225
Ophiocordyceps camponoti-rufipedis Ophun1|5370
Ophiocordyceps kimflemingae Ophio5|7652
Ophiocordyceps subramaniannii Hirsu2|1662

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6621
MSQTVGGWELTVGIEIHAQLNTARKLFSPALTSFQDDPNSHVALFDVSIPGSQPLMQKEVLLPAIRAALALDCDI
QPVSRFDRKHYFWWDQPSGYQITQYYEPFAKNGHIKLLARDGIAPEDGESVTVRIKQVQLEQDTAKTQAGQIENE
HLLDFNRAGVPLIEIITEPDMHHPRTAAVFVRKVQLLLATVDACVSGMEMGGLRADVNVSVRKTDSLDTRLGTRT
EIKNLSTPKAVENAIIAERDRQISMLQSGGVVQSETRGWTLGATETKRLRGKEGEVDYRYMPDPDIAPLIIGPDV
VEALRTSLPMMPDIEFDSLMTDYGLAKKDAGLLLMRNNNDARVEYFYRVLHLLHQRIQAEHDGKAMPDWKNYSTL
VANWVVNELGRLPTSRADAMVPSELEFTQDGECPQVPASSLSSILYHLYCKKIVGSVAKELLLAQYHGDIKGSVD
EAIGDNDLWFKEIDGPEYIALADEVMAQDPKLLRKLVQCKTELPQGKLMYLVGKMMQQGPTGRIDPETAEKMLRS
RVEKLRVP*
Coding >OphauB2|6621
ATGTCTCAGACGGTTGGCGGATGGGAGCTCACAGTTGGCATTGAGATACATGCTCAACTGAACACTGCGCGCAAG
CTCTTTTCACCGGCACTGACATCCTTTCAAGACGACCCCAACAGCCATGTGGCTCTGTTTGATGTTTCTATACCG
GGAAGTCAGCCTTTAATGCAGAAGGAAGTGCTTCTACCAGCGATACGTGCTGCTCTAGCTCTGGACTGCGACATA
CAGCCAGTCAGCCGGTTCGACAGAAAACACTACTTCTGGTGGGATCAGCCCTCGGGATACCAAATCACGCAATAT
TACGAGCCTTTTGCCAAGAATGGGCATATAAAGCTCTTGGCACGAGATGGCATTGCTCCAGAGGATGGAGAGAGC
GTCACCGTGCGCATCAAGCAGGTCCAGCTCGAACAGGATACAGCAAAAACACAGGCAGGGCAGATTGAAAATGAG
CATTTGCTCGATTTCAATCGAGCTGGTGTGCCTCTTATTGAGATTATCACAGAGCCCGATATGCACCATCCGCGG
ACAGCTGCAGTCTTTGTTCGCAAAGTGCAGTTACTACTAGCCACTGTAGATGCTTGCGTCTCAGGCATGGAAATG
GGTGGCCTTCGAGCCGATGTCAATGTCTCAGTGCGCAAAACTGACAGCCTAGATACAAGACTTGGAACGCGGACC
GAGATCAAGAATTTGAGCACTCCCAAAGCTGTCGAGAATGCCATCATTGCCGAGAGAGATCGCCAAATCTCCATG
TTACAATCTGGCGGTGTTGTGCAGAGCGAGACGCGCGGATGGACTCTGGGAGCCACAGAGACGAAGCGGCTCCGT
GGAAAGGAAGGAGAAGTCGACTATCGCTACATGCCTGATCCGGATATTGCGCCTCTGATTATCGGGCCAGATGTT
GTAGAGGCGCTGCGCACGTCACTGCCTATGATGCCAGACATTGAGTTTGATTCCTTGATGACCGACTATGGCCTT
GCAAAAAAAGATGCTGGGTTATTGTTGATGCGCAACAATAATGATGCTCGTGTCGAGTACTTTTACCGCGTGTTG
CACTTGCTGCATCAAAGGATCCAAGCTGAACATGATGGGAAAGCAATGCCAGACTGGAAAAACTATTCAACTCTG
GTTGCAAATTGGGTCGTCAATGAACTCGGCCGCCTTCCCACAAGCAGAGCAGACGCAATGGTGCCAAGTGAGCTT
GAATTTACGCAGGATGGCGAATGCCCTCAAGTTCCAGCCTCGAGTCTCTCGTCGATATTATATCACCTCTACTGC
AAGAAAATTGTGGGTAGTGTGGCCAAGGAGTTACTTTTGGCACAGTACCATGGTGATATTAAAGGAAGTGTCGAT
GAAGCAATTGGCGACAACGATCTCTGGTTCAAAGAGATTGATGGCCCAGAATATATTGCTCTAGCAGATGAAGTA
ATGGCTCAAGATCCAAAGCTGCTCCGCAAACTTGTACAGTGCAAAACAGAATTGCCCCAAGGCAAGCTCATGTAC
CTGGTTGGTAAAATGATGCAGCAGGGCCCGACGGGACGCATTGACCCAGAGACGGCTGAGAAGATGCTTAGAAGC
CGGGTCGAGAAGCTTCGGGTACCATGA
Transcript >OphauB2|6621
ATGTCTCAGACGGTTGGCGGATGGGAGCTCACAGTTGGCATTGAGATACATGCTCAACTGAACACTGCGCGCAAG
CTCTTTTCACCGGCACTGACATCCTTTCAAGACGACCCCAACAGCCATGTGGCTCTGTTTGATGTTTCTATACCG
GGAAGTCAGCCTTTAATGCAGAAGGAAGTGCTTCTACCAGCGATACGTGCTGCTCTAGCTCTGGACTGCGACATA
CAGCCAGTCAGCCGGTTCGACAGAAAACACTACTTCTGGTGGGATCAGCCCTCGGGATACCAAATCACGCAATAT
TACGAGCCTTTTGCCAAGAATGGGCATATAAAGCTCTTGGCACGAGATGGCATTGCTCCAGAGGATGGAGAGAGC
GTCACCGTGCGCATCAAGCAGGTCCAGCTCGAACAGGATACAGCAAAAACACAGGCAGGGCAGATTGAAAATGAG
CATTTGCTCGATTTCAATCGAGCTGGTGTGCCTCTTATTGAGATTATCACAGAGCCCGATATGCACCATCCGCGG
ACAGCTGCAGTCTTTGTTCGCAAAGTGCAGTTACTACTAGCCACTGTAGATGCTTGCGTCTCAGGCATGGAAATG
GGTGGCCTTCGAGCCGATGTCAATGTCTCAGTGCGCAAAACTGACAGCCTAGATACAAGACTTGGAACGCGGACC
GAGATCAAGAATTTGAGCACTCCCAAAGCTGTCGAGAATGCCATCATTGCCGAGAGAGATCGCCAAATCTCCATG
TTACAATCTGGCGGTGTTGTGCAGAGCGAGACGCGCGGATGGACTCTGGGAGCCACAGAGACGAAGCGGCTCCGT
GGAAAGGAAGGAGAAGTCGACTATCGCTACATGCCTGATCCGGATATTGCGCCTCTGATTATCGGGCCAGATGTT
GTAGAGGCGCTGCGCACGTCACTGCCTATGATGCCAGACATTGAGTTTGATTCCTTGATGACCGACTATGGCCTT
GCAAAAAAAGATGCTGGGTTATTGTTGATGCGCAACAATAATGATGCTCGTGTCGAGTACTTTTACCGCGTGTTG
CACTTGCTGCATCAAAGGATCCAAGCTGAACATGATGGGAAAGCAATGCCAGACTGGAAAAACTATTCAACTCTG
GTTGCAAATTGGGTCGTCAATGAACTCGGCCGCCTTCCCACAAGCAGAGCAGACGCAATGGTGCCAAGTGAGCTT
GAATTTACGCAGGATGGCGAATGCCCTCAAGTTCCAGCCTCGAGTCTCTCGTCGATATTATATCACCTCTACTGC
AAGAAAATTGTGGGTAGTGTGGCCAAGGAGTTACTTTTGGCACAGTACCATGGTGATATTAAAGGAAGTGTCGAT
GAAGCAATTGGCGACAACGATCTCTGGTTCAAAGAGATTGATGGCCCAGAATATATTGCTCTAGCAGATGAAGTA
ATGGCTCAAGATCCAAAGCTGCTCCGCAAACTTGTACAGTGCAAAACAGAATTGCCCCAAGGCAAGCTCATGTAC
CTGGTTGGTAAAATGATGCAGCAGGGCCCGACGGGACGCATTGACCCAGAGACGGCTGAGAAGATGCTTAGAAGC
CGGGTCGAGAAGCTTCGGGTACCATGA
Gene >OphauB2|6621
ATGTCTCAGACGGTTGGCGGATGGGAGCTCACAGTTGGCATTGAGATACATGCTCAACTGAACACTGCGCGCAAG
CTCTTTTCACCGGCACTGACATCCTTTCAAGACGACCCCAACAGCCATGTGGCTCTGTTTGATGTTTCTATACCG
GGAAGTCAGCCTTTAATGCAGAAGGAAGTGCTTCTACCAGCGATACGTGCTGCTCTAGCTCTGGACTGCGACATA
CAGCCAGTCAGCCGGTTCGACAGAAAACACTACTTCTGGTGGGATCAGCCCTCGGGATACCAAATCACGCAATAT
TACGAGCCTTTTGCCAAGAATGGGCATATAAAGCTCTTGGCACGAGATGGCATTGCTCCAGAGGATGGAGAGAGC
GTCACCGTGCGCATCAAGCAGGTCCAGCTCGAACAGGATACAGCAAAAACACAGGCAGGGCAGATTGAAAATGAG
CATTTGCTCGATTTCAATCGAGCTGGTGTGCCTCTTATTGAGATTATCACAGAGCCCGATATGCACCATCCGCGG
ACAGCTGCAGTCTTTGTTCGCAAAGTGCAGTTACTACTAGCCACTGTAGATGCTTGCGTCTCAGGCATGGAAATG
GGTGGCCTTCGAGCCGATGTCAATGTCTCAGTGCGCAAAACTGACAGCCTAGATACAAGACTTGGAACGCGGACC
GAGATCAAGAATTTGAGCACTCCCAAAGCTGTCGAGAATGCCATCATTGCCGAGAGAGATCGCCAAATCTCCATG
TTACAATCTGGCGGTGTTGTGCAGAGCGAGACGCGCGGATGGACTCTGGGAGCCACAGAGACGAAGCGGCTCCGT
GGAAAGGAAGGAGAAGTCGACTATCGCTACATGCCTGATCCGGATATTGCGCCTCTGATTATCGGGCCAGATGTT
GTAGAGGCGCTGCGCACGTCACTGCCTATGATGCCAGACATTGAGTTTGATTCCTTGATGACCGACTATGGCCTT
GCAAAAAAAGATGCTGGGTTATTGTTGATGCGCAACAATAATGATGCTCGTGTCGAGTACTTTTACCGCGTGTTG
CACTTGCTGCATCAAAGGATCCAAGCTGAACATGATGGGAAAGCAATGCCAGACTGGAAAAACTATTCAACTCTG
GTTGCAAATTGGGTCGTCAATGAACTCGGCCGCCTTCCCACAAGCAGAGCAGACGCAATGGTGCCAAGTGAGCTT
GAATTTACGCAGGATGGCGAATGCCCTCAAGTTCCAGCCTCGAGTCTCTCGTCGATATTATATCACCTCTACTGC
AAGAAAATTGTGGGTAGTGTGGCCAAGGAGTTACTTTTGGCACAGTACCATGGTGATATTAAAGGAAGTGTCGAT
GAAGCAATTGGCGACAACGATCTCTGGTTCAAAGAGATTGATGGCCCAGAATATATTGCTCTAGCAGATGAAGTA
ATGGCTCAAGATCCAAAGCTGCTCCGCAAACTTGTACAGTGCAAAACAGAATTGCCCCAAGGCAAGCTCATGTAC
CTGGTTGGTAAAATGATGCAGCAGGGCCCGACGGGACGCATTGACCCAGAGACGGCTGAGAAGATGCTTAGAAGC
CGGGTCGAGAAGCTTCGGGTACCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail