Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6619
Gene name
LocationContig_61:93964..95819
Strand-
Gene length (bp)1855
Transcript length (bp)1776
Coding sequence length (bp)1776
Protein length (aa) 592

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20237 DUF6594 Family of unknown function (DUF6594) 1.1E-38 308 582

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 517 539 22
2 544 562 18
3 572 590 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6619
METQLESPANTGPSTPESATSGNQHYETCSQVDNKDARIETQNDTAENGAKTEPSESPEVDAVKLGADLSSPGPT
SVSPLLSPKTSDHGRPRAATVEECSDQGEPPPRATSTPSLSSEVSRRSCLATPTTPRSSKLSITSETTVTQTPHT
TEKHSETTGAAGLSRRPSNTFHSPRPQPRRPSALDFLVADSVTGIPRAALETAYRRVEMGTSRASPARSVLSRRP
SLSREISRPVDSKTHAPWTSSRTGPSRAVSMPSHQASSVFPQTYTPLRPGTATLPAASMPLSYPASSVSQTGWTV
DKTPMSGYQLVAAKLVGGLGGPPVVPAYRRFEALNHRLLLYMQADLVDLESHLRDLDAQDTAERAYGAIPASRRH
ERWTNSILTQQRAEVLGQIGYKLQQYNNILSSMRKLQQPPPPPLAEVHAYKSWLVSSRLIAEDETRFLDETEDLI
SLAHQPAPDSLIGDDTATPMPHLPEPIASFLPSTRQVREPEGASSDCAARTSQPQARDALGRQLSQLVLAMCIAF
FVPVATFTVISSFAGRITVVLFVEAIVTMALLQSGLVHLLDASSSNWLLSASIYFGAMAAVAGLLC*
Coding >OphauB2|6619
ATGGAGACCCAACTCGAGTCGCCCGCAAACACAGGCCCATCTACGCCGGAAAGTGCCACCAGTGGTAATCAGCAT
TACGAGACATGCAGTCAAGTAGACAACAAAGATGCGAGGATAGAGACACAAAACGACACAGCCGAAAATGGTGCC
AAGACGGAACCATCAGAGTCTCCAGAGGTAGATGCCGTCAAGTTAGGTGCTGACTTGTCCTCACCTGGTCCAACG
TCCGTCTCGCCTCTCTTATCTCCCAAGACGTCTGACCATGGGCGGCCAAGGGCTGCAACGGTCGAGGAATGTTCT
GACCAGGGCGAGCCTCCGCCACGTGCCACTTCGACGCCCTCTTTATCGTCAGAGGTTTCTCGTCGCTCTTGTCTG
GCAACGCCGACAACTCCCAGGAGCTCCAAATTATCCATCACGAGCGAGACGACGGTGACACAGACACCGCATACG
ACGGAGAAACACAGTGAAACGACAGGGGCGGCTGGACTCTCGCGCCGTCCCTCCAACACGTTCCATTCTCCTCGT
CCGCAACCAAGGCGACCGAGTGCCTTGGATTTTCTTGTTGCCGACTCCGTCACCGGCATTCCAAGAGCAGCATTG
GAAACAGCATACCGACGAGTCGAAATGGGCACCAGTCGTGCCTCTCCCGCTCGCTCTGTGCTCAGCCGTCGACCT
AGTCTCTCGAGAGAGATTTCAAGACCTGTCGACTCAAAAACGCATGCGCCCTGGACATCAAGTCGCACAGGGCCA
AGCCGAGCTGTCTCGATGCCGTCGCACCAAGCTTCGTCCGTCTTTCCTCAAACCTATACGCCTTTGCGGCCTGGC
ACAGCGACTCTGCCGGCAGCCAGCATGCCCCTTTCGTACCCCGCCTCTAGCGTCTCGCAGACGGGCTGGACCGTG
GACAAGACGCCAATGAGCGGCTATCAGCTTGTCGCTGCCAAGCTTGTAGGGGGTCTCGGCGGACCACCAGTCGTA
CCAGCATACCGACGGTTCGAGGCCCTCAATCACCGCTTGCTGTTGTACATGCAGGCCGATCTTGTTGACCTAGAG
AGCCATCTGCGCGACCTAGATGCCCAGGACACTGCCGAGCGAGCCTATGGAGCCATACCAGCGTCGCGACGTCAT
GAGCGTTGGACTAACAGCATACTGACACAGCAGAGGGCCGAAGTCCTTGGCCAGATTGGCTACAAGCTACAACAG
TACAACAACATCTTGTCCTCTATGAGAAAGCTGCAACAGCCGCCTCCTCCGCCCTTGGCAGAGGTACACGCCTAC
AAGTCGTGGCTCGTAAGCAGCCGGCTCATTGCAGAAGACGAGACGCGCTTTCTCGACGAGACGGAAGATCTCATC
TCTCTTGCCCATCAGCCTGCCCCGGACTCTTTAATCGGCGACGACACCGCGACCCCAATGCCTCATTTGCCTGAG
CCAATTGCATCCTTCCTGCCAAGCACCAGACAAGTCCGCGAGCCCGAAGGAGCCAGCTCAGACTGCGCCGCTCGC
ACCAGCCAGCCGCAAGCCCGTGATGCGTTGGGAAGACAACTCTCTCAGCTTGTGCTGGCCATGTGCATCGCCTTT
TTTGTCCCCGTTGCCACTTTTACCGTCATTTCAAGTTTTGCCGGGCGCATCACTGTGGTGCTCTTCGTCGAAGCT
ATAGTTACAATGGCACTGCTCCAGTCCGGTCTTGTGCATTTACTAGACGCATCATCTTCCAATTGGCTTCTTTCA
GCTAGTATTTATTTTGGTGCCATGGCAGCAGTCGCTGGTCTGCTTTGTTGA
Transcript >OphauB2|6619
ATGGAGACCCAACTCGAGTCGCCCGCAAACACAGGCCCATCTACGCCGGAAAGTGCCACCAGTGGTAATCAGCAT
TACGAGACATGCAGTCAAGTAGACAACAAAGATGCGAGGATAGAGACACAAAACGACACAGCCGAAAATGGTGCC
AAGACGGAACCATCAGAGTCTCCAGAGGTAGATGCCGTCAAGTTAGGTGCTGACTTGTCCTCACCTGGTCCAACG
TCCGTCTCGCCTCTCTTATCTCCCAAGACGTCTGACCATGGGCGGCCAAGGGCTGCAACGGTCGAGGAATGTTCT
GACCAGGGCGAGCCTCCGCCACGTGCCACTTCGACGCCCTCTTTATCGTCAGAGGTTTCTCGTCGCTCTTGTCTG
GCAACGCCGACAACTCCCAGGAGCTCCAAATTATCCATCACGAGCGAGACGACGGTGACACAGACACCGCATACG
ACGGAGAAACACAGTGAAACGACAGGGGCGGCTGGACTCTCGCGCCGTCCCTCCAACACGTTCCATTCTCCTCGT
CCGCAACCAAGGCGACCGAGTGCCTTGGATTTTCTTGTTGCCGACTCCGTCACCGGCATTCCAAGAGCAGCATTG
GAAACAGCATACCGACGAGTCGAAATGGGCACCAGTCGTGCCTCTCCCGCTCGCTCTGTGCTCAGCCGTCGACCT
AGTCTCTCGAGAGAGATTTCAAGACCTGTCGACTCAAAAACGCATGCGCCCTGGACATCAAGTCGCACAGGGCCA
AGCCGAGCTGTCTCGATGCCGTCGCACCAAGCTTCGTCCGTCTTTCCTCAAACCTATACGCCTTTGCGGCCTGGC
ACAGCGACTCTGCCGGCAGCCAGCATGCCCCTTTCGTACCCCGCCTCTAGCGTCTCGCAGACGGGCTGGACCGTG
GACAAGACGCCAATGAGCGGCTATCAGCTTGTCGCTGCCAAGCTTGTAGGGGGTCTCGGCGGACCACCAGTCGTA
CCAGCATACCGACGGTTCGAGGCCCTCAATCACCGCTTGCTGTTGTACATGCAGGCCGATCTTGTTGACCTAGAG
AGCCATCTGCGCGACCTAGATGCCCAGGACACTGCCGAGCGAGCCTATGGAGCCATACCAGCGTCGCGACGTCAT
GAGCGTTGGACTAACAGCATACTGACACAGCAGAGGGCCGAAGTCCTTGGCCAGATTGGCTACAAGCTACAACAG
TACAACAACATCTTGTCCTCTATGAGAAAGCTGCAACAGCCGCCTCCTCCGCCCTTGGCAGAGGTACACGCCTAC
AAGTCGTGGCTCGTAAGCAGCCGGCTCATTGCAGAAGACGAGACGCGCTTTCTCGACGAGACGGAAGATCTCATC
TCTCTTGCCCATCAGCCTGCCCCGGACTCTTTAATCGGCGACGACACCGCGACCCCAATGCCTCATTTGCCTGAG
CCAATTGCATCCTTCCTGCCAAGCACCAGACAAGTCCGCGAGCCCGAAGGAGCCAGCTCAGACTGCGCCGCTCGC
ACCAGCCAGCCGCAAGCCCGTGATGCGTTGGGAAGACAACTCTCTCAGCTTGTGCTGGCCATGTGCATCGCCTTT
TTTGTCCCCGTTGCCACTTTTACCGTCATTTCAAGTTTTGCCGGGCGCATCACTGTGGTGCTCTTCGTCGAAGCT
ATAGTTACAATGGCACTGCTCCAGTCCGGTCTTGTGCATTTACTAGACGCATCATCTTCCAATTGGCTTCTTTCA
GCTAGTATTTATTTTGGTGCCATGGCAGCAGTCGCTGGTCTGCTTTGTTGA
Gene >OphauB2|6619
ATGGAGACCCAACTCGAGTCGCCCGCAAACACAGGCCCATCTACGCCGGAAAGTGCCACCAGTGGTAATCAGCAT
TACGAGACATGCAGTCAAGTAGACAACAAAGATGCGAGGATAGAGACACAAAACGACACAGCCGAAAATGGTGCC
AAGACGGAACCATCAGAGTCTCCAGAGGTAGATGCCGTCAAGTTAGGTGCTGACTTGTCCTCACCTGGTCCAACG
TCCGTCTCGCCTCTCTTATCTCCCAAGACGTCTGACCATGGGCGGCCAAGGGCTGCAACGGTCGAGGAATGTTCT
GACCAGGGCGAGCCTCCGCCACGTGCCACTTCGACGCCCTCTTTATCGTCAGAGGTTTCTCGTCGCTCTTGTCTG
GCAACGCCGACAACTCCCAGGAGCTCCAAATTATCCATCACGAGCGAGACGACGGTGACACAGACACCGCATACG
ACGGAGAAACACAGTGAAACGACAGGGGCGGCTGGACTCTCGCGCCGTCCCTCCAACACGTTCCATTCTCCTCGT
CCGCAACCAAGGCGACCGAGTGCCTTGGATTTTCTTGTTGCCGACTCCGTCACCGGCATTCCAAGAGCAGCATTG
GAAACAGCATACCGACGAGTCGAAATGGGCACCAGTCGTGCCTCTCCCGCTCGCTCTGTGCTCAGCCGTCGACCT
AGTCTCTCGAGAGAGATTTCAAGACCTGTCGACTCAAAAACGCATGCGCCCTGGACATCAAGTCGCACAGGGCCA
AGCCGAGCTGTCTCGATGCCGTCGCACCAAGCTTCGTCCGTCTTTCCTCAAACCTATACGCCTTTGCGGCCTGGC
ACAGCGACTCTGCCGGCAGCCAGCATGCCCCTTTCGTACCCCGCCTCTAGCGTCTCGCAGACGGGCTGGACCGTG
GACAAGACGCCAATGAGCGGCTATCAGCTTGTCGCTGCCAAGCTTGTAGGGGGTCTCGGCGGACCACCAGTCGTA
CCAGCATACCGACGGTTCGAGGCCCTCAATCACCGCTTGCTGTTGTACATGCAGGCCGATCTTGTTGACCTAGAG
AGCCATCTGCGCGACCTAGATGCCCAGGACACTGCCGAGCGAGCCTATGGAGCCATACCAGCGTCGCGACGTCAT
GAGCGTTGGACTAACAGCATACTGACACAGCAGAGGGCCGAAGTCCTTGGCCAGATTGGCTACAAGCTACAACAG
TACAGTATGGCCAAGTATTTTCTTCTTCTCCGCCGTCGACTCCTAAAAATTGAGCCAGGAGTAGGGAGCTAATCG
CCGTAAAGACAACATCTTGTCCTCTATGAGAAAGCTGCAACAGCCGCCTCCTCCGCCCTTGGCAGAGGTACACGC
CTACAAGTCGTGGCTCGTAAGCAGCCGGCTCATTGCAGAAGACGAGACGCGCTTTCTCGACGAGACGGAAGATCT
CATCTCTCTTGCCCATCAGCCTGCCCCGGACTCTTTAATCGGCGACGACACCGCGACCCCAATGCCTCATTTGCC
TGAGCCAATTGCATCCTTCCTGCCAAGCACCAGACAAGTCCGCGAGCCCGAAGGAGCCAGCTCAGACTGCGCCGC
TCGCACCAGCCAGCCGCAAGCCCGTGATGCGTTGGGAAGACAACTCTCTCAGCTTGTGCTGGCCATGTGCATCGC
CTTTTTTGTCCCCGTTGCCACTTTTACCGTCATTTCAAGTTTTGCCGGGCGCATCACTGTGGTGCTCTTCGTCGA
AGCTATAGTTACAATGGCACTGCTCCAGTCCGGTCTTGTGCATTTACTAGACGCATCATCTTCCAATTGGCTTCT
TTCAGCTAGTATTTATTTTGGTGCCATGGCAGCAGTCGCTGGTCTGCTTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail