Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6611
Gene name
LocationContig_61:67431..70665
Strand+
Gene length (bp)3234
Transcript length (bp)3234
Coding sequence length (bp)3234
Protein length (aa) 1078

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 1.3E-16 383 467

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74365|SOL1_SCHPO SWI/SNF chromatin-remodeling complex subunit sol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sol1 PE=1 SV=1 354 1059 1.0E-42
sp|P09547|SWI1_YEAST SWI/SNF chromatin-remodeling complex subunit SWI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI1 PE=1 SV=1 754 906 1.0E-08
sp|A2CG63|ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus GN=Arid4b PE=1 SV=1 385 468 2.0E-07
sp|Q4LE39|ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens GN=ARID4B PE=1 SV=2 385 468 3.0E-07
sp|Q9JKB5|ARI4B_RAT AT-rich interactive domain-containing protein 4B OS=Rattus norvegicus GN=Arid4b PE=1 SV=1 385 468 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74365|SOL1_SCHPO SWI/SNF chromatin-remodeling complex subunit sol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sol1 PE=1 SV=1 354 1059 1.0E-42
sp|P09547|SWI1_YEAST SWI/SNF chromatin-remodeling complex subunit SWI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI1 PE=1 SV=1 754 906 1.0E-08
sp|A2CG63|ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus GN=Arid4b PE=1 SV=1 385 468 2.0E-07
sp|Q4LE39|ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens GN=ARID4B PE=1 SV=2 385 468 3.0E-07
sp|Q9JKB5|ARI4B_RAT AT-rich interactive domain-containing protein 4B OS=Rattus norvegicus GN=Arid4b PE=1 SV=1 385 468 3.0E-07
sp|Q4H3P5|DRI_CIOIN Protein dead ringer homolog OS=Ciona intestinalis GN=Ci-DRIL1/2 PE=2 SV=1 380 467 7.0E-07
sp|A6NKF2|ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens GN=ARID3C PE=3 SV=1 383 467 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6611
MSAWMNDAVPTHNGNGFPHVNDANAAAMMDPSAFMNNPPQFNPNQFANPQHAQQQQQQQHQQHIAPSGLQNGPMR
HASPAAFQASNPPNQAPNSVYQTNSVIPSKRPRPREDSISGSPRQNVAMQPPSRSGTPQQNFSAGYQTGAPMSTQ
LPHLQPNGSANASPSPIMGNQMRQLSVPQRVATASPHPFSPSAQQFGGAPQTSPGPSEHGTPQPSAYMQNMSSGY
NPGFAPSNPRPSPNPNVMPGGQMMAQQMPQQMGQQMGQQMGQQMGQQMGQMPPPMYQQMQQHQMQQPQQQQQMSQ
QGQPQRQQNMMEQQKMAAYQMRLQHHLQGNAQMQQMHAQMQSQNMGRGMMPKQQQMGNVQNGQMAQPGVRLQQPR
PLASINPEQFMKNLAALMNAKGLPLDLNPVIGDRAVNLVSLFQVVQSRGGHKPVTATNGWAHVAQTLNLPVHVPT
VAPSLKQVYERNLLKFEEAWMAQQQKQRMVQQNAGMMSQGAPHKALPPGQQMNQGPVQPGQPSHVQQQQQAVKPG
QPPVNGFSAPQAQPPAQASIGPGHNRNSLSRGVDSSAASEFSMQSPAQPRARSVTASQMDGRQSAPVVVATPEQP
VSDEYIPRARPLDTHAGFVLDAFQNLTAERERFEPFVPSINDLGNVDIHTLTCGLQSGVHVEVRVALNTLATISA
SPNPAHFIQLRFCSDLVDALVDCADQQIDLLAEHTAEVSDEILLSSYEDVVRACRIERQSVKEMPIFGSTEFELD
HAVDRLISITTIMRNLSFPGEQNGNHDFLADESVIKMLCVIIRYLGTRTMLLRTHMNTLDFMKDVVVLLSNIAGS
IEIPGREQAMCLLQFLLAFAPAPGPIASDGTLFFPPYEPSLHPYAPHAIDSLAKLLARDEPNRGFYRSLFAADAT
STPAYDLMTRAFALAISPIPDKTREQNRSSLQPMLIETRKPFLMQGLLAAEVLSSLAPGPESGLARAWLASANDL
AHVLYRLVHDLSIMYERPQMIRGPNRSMARKDPEFVYIVVVAVALLRRLLEKAKDPSGVTWAVPGNLLPHSEMLL
EALALQGSEWTREGMLPQLTAIFNSSS*
Coding >OphauB2|6611
ATGAGCGCCTGGATGAACGACGCCGTCCCTACGCACAATGGCAACGGCTTTCCACACGTCAACGACGCCAACGCT
GCCGCAATGATGGATCCATCAGCCTTCATGAACAACCCACCACAGTTTAATCCCAATCAATTCGCGAACCCACAA
CATGCTCAGCAGCAACAACAGCAGCAACACCAACAGCATATTGCTCCCTCTGGCCTTCAAAACGGCCCCATGCGA
CACGCATCACCTGCTGCATTTCAAGCTTCCAACCCTCCAAACCAGGCTCCCAACTCTGTCTACCAGACCAACTCG
GTGATTCCCTCAAAACGCCCTCGGCCGCGCGAGGACAGCATCTCGGGCTCTCCCAGGCAAAATGTCGCAATGCAG
CCGCCATCGCGCTCAGGAACCCCCCAACAAAATTTTTCCGCTGGCTACCAAACCGGTGCTCCAATGTCGACGCAG
CTTCCCCATCTCCAACCGAACGGCTCCGCCAACGCCAGCCCTTCCCCCATCATGGGCAACCAAATGCGACAGCTA
AGCGTCCCTCAGAGGGTTGCGACAGCCTCGCCCCATCCATTCTCGCCCAGTGCCCAGCAATTCGGCGGCGCGCCC
CAAACATCACCAGGCCCTTCGGAGCATGGCACCCCCCAGCCGAGCGCATACATGCAAAATATGTCATCTGGCTAT
AATCCCGGATTTGCGCCCTCGAACCCACGTCCCTCGCCCAATCCAAACGTCATGCCTGGTGGTCAAATGATGGCT
CAGCAGATGCCGCAGCAAATGGGTCAGCAAATGGGTCAGCAAATGGGCCAGCAAATGGGCCAGCAAATGGGCCAA
ATGCCACCACCCATGTATCAGCAAATGCAGCAGCATCAGATGCAGCAACCCCAACAGCAGCAGCAAATGTCGCAA
CAAGGCCAGCCTCAACGACAACAGAATATGATGGAGCAACAAAAGATGGCAGCTTATCAGATGCGCCTCCAGCAT
CACCTGCAGGGAAATGCGCAGATGCAACAGATGCACGCTCAAATGCAATCTCAAAACATGGGACGCGGAATGATG
CCTAAACAGCAACAGATGGGCAATGTGCAAAACGGCCAGATGGCTCAGCCGGGCGTGCGCTTGCAGCAGCCTCGG
CCGCTGGCTAGCATCAACCCTGAGCAATTCATGAAGAACCTGGCGGCTCTCATGAATGCCAAAGGGCTCCCTCTG
GATTTAAATCCCGTCATTGGAGACCGAGCCGTCAATCTCGTTTCGCTTTTTCAGGTGGTGCAATCCAGAGGAGGC
CACAAGCCAGTAACTGCTACCAACGGCTGGGCGCATGTGGCTCAGACGCTCAATCTTCCGGTTCACGTGCCTACC
GTGGCGCCGTCTTTGAAGCAGGTTTATGAGCGCAACTTGCTCAAGTTTGAAGAGGCATGGATGGCACAGCAGCAG
AAGCAGCGCATGGTGCAGCAAAACGCGGGCATGATGAGCCAGGGCGCTCCACACAAAGCCTTGCCCCCGGGACAG
CAGATGAATCAGGGACCGGTACAACCTGGGCAACCATCTCATGTGCAACAGCAACAGCAAGCCGTGAAACCTGGC
CAGCCTCCTGTCAATGGCTTCTCTGCACCTCAAGCACAGCCTCCTGCACAGGCAAGCATTGGACCTGGCCACAAC
AGAAACAGCTTGTCGAGAGGCGTTGATTCTTCGGCTGCCAGCGAATTCTCGATGCAGTCGCCGGCGCAGCCCCGC
GCCAGAAGTGTCACTGCGAGCCAGATGGACGGCCGACAGTCTGCTCCAGTTGTTGTTGCCACGCCGGAGCAGCCA
GTATCCGACGAATATATTCCTAGAGCGCGCCCGTTGGATACACATGCTGGCTTCGTGCTTGACGCCTTCCAAAAT
TTGACGGCTGAAAGGGAGAGATTTGAGCCCTTTGTGCCGAGCATCAATGATTTAGGAAACGTCGACATCCACACT
CTCACATGTGGCCTTCAGAGTGGTGTTCACGTAGAAGTTCGAGTTGCACTCAACACCTTGGCCACGATTTCCGCA
TCACCCAACCCGGCGCATTTTATACAGCTCAGATTCTGCAGCGACCTGGTTGACGCCTTGGTGGATTGTGCCGAT
CAACAGATTGATCTATTAGCAGAGCACACTGCCGAAGTGTCGGACGAGATCTTGCTTTCATCCTACGAAGACGTG
GTTCGAGCCTGCCGCATCGAGCGCCAGAGCGTCAAAGAAATGCCCATCTTTGGCAGCACCGAGTTCGAGTTGGAC
CATGCTGTCGACCGACTGATAAGCATCACAACCATTATGCGCAATTTATCGTTTCCCGGAGAGCAGAATGGCAAC
CACGACTTTTTAGCAGATGAGTCAGTCATCAAGATGCTCTGCGTCATTATTCGCTATCTCGGCACTCGAACCATG
CTGCTGCGTACGCACATGAATACCCTCGACTTCATGAAGGATGTCGTCGTTTTACTCTCCAACATTGCCGGCTCC
ATAGAAATACCTGGGCGCGAGCAGGCCATGTGTCTGTTGCAATTTCTACTGGCGTTTGCCCCAGCACCTGGCCCT
ATTGCATCCGACGGCACACTCTTCTTCCCGCCATATGAGCCCAGTCTACACCCGTATGCTCCTCATGCCATTGAC
TCACTTGCCAAGCTACTTGCTCGCGACGAGCCAAATCGAGGCTTCTACAGGTCCTTGTTCGCAGCCGATGCTACC
AGCACCCCTGCGTACGACTTGATGACGCGCGCTTTCGCCTTGGCAATATCGCCGATTCCAGACAAGACTCGTGAA
CAGAATCGGTCGTCACTGCAGCCAATGCTCATTGAAACGCGCAAGCCATTTCTCATGCAGGGCTTGCTTGCTGCT
GAAGTGCTCTCATCTCTGGCGCCTGGACCTGAATCGGGCCTGGCCAGGGCCTGGCTGGCATCTGCCAACGACTTG
GCTCACGTTTTGTACCGGCTCGTGCATGATTTAAGCATCATGTATGAGAGACCCCAGATGATTCGAGGCCCAAAC
CGATCCATGGCCAGAAAGGACCCCGAGTTTGTCTACATTGTTGTCGTGGCCGTGGCACTTTTGCGACGGCTTCTG
GAAAAGGCCAAGGATCCCAGCGGCGTGACATGGGCTGTCCCTGGAAACCTACTGCCACACTCGGAAATGCTGCTC
GAGGCCTTGGCCCTGCAAGGTTCCGAGTGGACTCGCGAAGGGATGCTGCCCCAGCTCACGGCGATATTCAATAGT
TCCTCGTGA
Transcript >OphauB2|6611
ATGAGCGCCTGGATGAACGACGCCGTCCCTACGCACAATGGCAACGGCTTTCCACACGTCAACGACGCCAACGCT
GCCGCAATGATGGATCCATCAGCCTTCATGAACAACCCACCACAGTTTAATCCCAATCAATTCGCGAACCCACAA
CATGCTCAGCAGCAACAACAGCAGCAACACCAACAGCATATTGCTCCCTCTGGCCTTCAAAACGGCCCCATGCGA
CACGCATCACCTGCTGCATTTCAAGCTTCCAACCCTCCAAACCAGGCTCCCAACTCTGTCTACCAGACCAACTCG
GTGATTCCCTCAAAACGCCCTCGGCCGCGCGAGGACAGCATCTCGGGCTCTCCCAGGCAAAATGTCGCAATGCAG
CCGCCATCGCGCTCAGGAACCCCCCAACAAAATTTTTCCGCTGGCTACCAAACCGGTGCTCCAATGTCGACGCAG
CTTCCCCATCTCCAACCGAACGGCTCCGCCAACGCCAGCCCTTCCCCCATCATGGGCAACCAAATGCGACAGCTA
AGCGTCCCTCAGAGGGTTGCGACAGCCTCGCCCCATCCATTCTCGCCCAGTGCCCAGCAATTCGGCGGCGCGCCC
CAAACATCACCAGGCCCTTCGGAGCATGGCACCCCCCAGCCGAGCGCATACATGCAAAATATGTCATCTGGCTAT
AATCCCGGATTTGCGCCCTCGAACCCACGTCCCTCGCCCAATCCAAACGTCATGCCTGGTGGTCAAATGATGGCT
CAGCAGATGCCGCAGCAAATGGGTCAGCAAATGGGTCAGCAAATGGGCCAGCAAATGGGCCAGCAAATGGGCCAA
ATGCCACCACCCATGTATCAGCAAATGCAGCAGCATCAGATGCAGCAACCCCAACAGCAGCAGCAAATGTCGCAA
CAAGGCCAGCCTCAACGACAACAGAATATGATGGAGCAACAAAAGATGGCAGCTTATCAGATGCGCCTCCAGCAT
CACCTGCAGGGAAATGCGCAGATGCAACAGATGCACGCTCAAATGCAATCTCAAAACATGGGACGCGGAATGATG
CCTAAACAGCAACAGATGGGCAATGTGCAAAACGGCCAGATGGCTCAGCCGGGCGTGCGCTTGCAGCAGCCTCGG
CCGCTGGCTAGCATCAACCCTGAGCAATTCATGAAGAACCTGGCGGCTCTCATGAATGCCAAAGGGCTCCCTCTG
GATTTAAATCCCGTCATTGGAGACCGAGCCGTCAATCTCGTTTCGCTTTTTCAGGTGGTGCAATCCAGAGGAGGC
CACAAGCCAGTAACTGCTACCAACGGCTGGGCGCATGTGGCTCAGACGCTCAATCTTCCGGTTCACGTGCCTACC
GTGGCGCCGTCTTTGAAGCAGGTTTATGAGCGCAACTTGCTCAAGTTTGAAGAGGCATGGATGGCACAGCAGCAG
AAGCAGCGCATGGTGCAGCAAAACGCGGGCATGATGAGCCAGGGCGCTCCACACAAAGCCTTGCCCCCGGGACAG
CAGATGAATCAGGGACCGGTACAACCTGGGCAACCATCTCATGTGCAACAGCAACAGCAAGCCGTGAAACCTGGC
CAGCCTCCTGTCAATGGCTTCTCTGCACCTCAAGCACAGCCTCCTGCACAGGCAAGCATTGGACCTGGCCACAAC
AGAAACAGCTTGTCGAGAGGCGTTGATTCTTCGGCTGCCAGCGAATTCTCGATGCAGTCGCCGGCGCAGCCCCGC
GCCAGAAGTGTCACTGCGAGCCAGATGGACGGCCGACAGTCTGCTCCAGTTGTTGTTGCCACGCCGGAGCAGCCA
GTATCCGACGAATATATTCCTAGAGCGCGCCCGTTGGATACACATGCTGGCTTCGTGCTTGACGCCTTCCAAAAT
TTGACGGCTGAAAGGGAGAGATTTGAGCCCTTTGTGCCGAGCATCAATGATTTAGGAAACGTCGACATCCACACT
CTCACATGTGGCCTTCAGAGTGGTGTTCACGTAGAAGTTCGAGTTGCACTCAACACCTTGGCCACGATTTCCGCA
TCACCCAACCCGGCGCATTTTATACAGCTCAGATTCTGCAGCGACCTGGTTGACGCCTTGGTGGATTGTGCCGAT
CAACAGATTGATCTATTAGCAGAGCACACTGCCGAAGTGTCGGACGAGATCTTGCTTTCATCCTACGAAGACGTG
GTTCGAGCCTGCCGCATCGAGCGCCAGAGCGTCAAAGAAATGCCCATCTTTGGCAGCACCGAGTTCGAGTTGGAC
CATGCTGTCGACCGACTGATAAGCATCACAACCATTATGCGCAATTTATCGTTTCCCGGAGAGCAGAATGGCAAC
CACGACTTTTTAGCAGATGAGTCAGTCATCAAGATGCTCTGCGTCATTATTCGCTATCTCGGCACTCGAACCATG
CTGCTGCGTACGCACATGAATACCCTCGACTTCATGAAGGATGTCGTCGTTTTACTCTCCAACATTGCCGGCTCC
ATAGAAATACCTGGGCGCGAGCAGGCCATGTGTCTGTTGCAATTTCTACTGGCGTTTGCCCCAGCACCTGGCCCT
ATTGCATCCGACGGCACACTCTTCTTCCCGCCATATGAGCCCAGTCTACACCCGTATGCTCCTCATGCCATTGAC
TCACTTGCCAAGCTACTTGCTCGCGACGAGCCAAATCGAGGCTTCTACAGGTCCTTGTTCGCAGCCGATGCTACC
AGCACCCCTGCGTACGACTTGATGACGCGCGCTTTCGCCTTGGCAATATCGCCGATTCCAGACAAGACTCGTGAA
CAGAATCGGTCGTCACTGCAGCCAATGCTCATTGAAACGCGCAAGCCATTTCTCATGCAGGGCTTGCTTGCTGCT
GAAGTGCTCTCATCTCTGGCGCCTGGACCTGAATCGGGCCTGGCCAGGGCCTGGCTGGCATCTGCCAACGACTTG
GCTCACGTTTTGTACCGGCTCGTGCATGATTTAAGCATCATGTATGAGAGACCCCAGATGATTCGAGGCCCAAAC
CGATCCATGGCCAGAAAGGACCCCGAGTTTGTCTACATTGTTGTCGTGGCCGTGGCACTTTTGCGACGGCTTCTG
GAAAAGGCCAAGGATCCCAGCGGCGTGACATGGGCTGTCCCTGGAAACCTACTGCCACACTCGGAAATGCTGCTC
GAGGCCTTGGCCCTGCAAGGTTCCGAGTGGACTCGCGAAGGGATGCTGCCCCAGCTCACGGCGATATTCAATAGT
TCCTCGTGA
Gene >OphauB2|6611
ATGAGCGCCTGGATGAACGACGCCGTCCCTACGCACAATGGCAACGGCTTTCCACACGTCAACGACGCCAACGCT
GCCGCAATGATGGATCCATCAGCCTTCATGAACAACCCACCACAGTTTAATCCCAATCAATTCGCGAACCCACAA
CATGCTCAGCAGCAACAACAGCAGCAACACCAACAGCATATTGCTCCCTCTGGCCTTCAAAACGGCCCCATGCGA
CACGCATCACCTGCTGCATTTCAAGCTTCCAACCCTCCAAACCAGGCTCCCAACTCTGTCTACCAGACCAACTCG
GTGATTCCCTCAAAACGCCCTCGGCCGCGCGAGGACAGCATCTCGGGCTCTCCCAGGCAAAATGTCGCAATGCAG
CCGCCATCGCGCTCAGGAACCCCCCAACAAAATTTTTCCGCTGGCTACCAAACCGGTGCTCCAATGTCGACGCAG
CTTCCCCATCTCCAACCGAACGGCTCCGCCAACGCCAGCCCTTCCCCCATCATGGGCAACCAAATGCGACAGCTA
AGCGTCCCTCAGAGGGTTGCGACAGCCTCGCCCCATCCATTCTCGCCCAGTGCCCAGCAATTCGGCGGCGCGCCC
CAAACATCACCAGGCCCTTCGGAGCATGGCACCCCCCAGCCGAGCGCATACATGCAAAATATGTCATCTGGCTAT
AATCCCGGATTTGCGCCCTCGAACCCACGTCCCTCGCCCAATCCAAACGTCATGCCTGGTGGTCAAATGATGGCT
CAGCAGATGCCGCAGCAAATGGGTCAGCAAATGGGTCAGCAAATGGGCCAGCAAATGGGCCAGCAAATGGGCCAA
ATGCCACCACCCATGTATCAGCAAATGCAGCAGCATCAGATGCAGCAACCCCAACAGCAGCAGCAAATGTCGCAA
CAAGGCCAGCCTCAACGACAACAGAATATGATGGAGCAACAAAAGATGGCAGCTTATCAGATGCGCCTCCAGCAT
CACCTGCAGGGAAATGCGCAGATGCAACAGATGCACGCTCAAATGCAATCTCAAAACATGGGACGCGGAATGATG
CCTAAACAGCAACAGATGGGCAATGTGCAAAACGGCCAGATGGCTCAGCCGGGCGTGCGCTTGCAGCAGCCTCGG
CCGCTGGCTAGCATCAACCCTGAGCAATTCATGAAGAACCTGGCGGCTCTCATGAATGCCAAAGGGCTCCCTCTG
GATTTAAATCCCGTCATTGGAGACCGAGCCGTCAATCTCGTTTCGCTTTTTCAGGTGGTGCAATCCAGAGGAGGC
CACAAGCCAGTAACTGCTACCAACGGCTGGGCGCATGTGGCTCAGACGCTCAATCTTCCGGTTCACGTGCCTACC
GTGGCGCCGTCTTTGAAGCAGGTTTATGAGCGCAACTTGCTCAAGTTTGAAGAGGCATGGATGGCACAGCAGCAG
AAGCAGCGCATGGTGCAGCAAAACGCGGGCATGATGAGCCAGGGCGCTCCACACAAAGCCTTGCCCCCGGGACAG
CAGATGAATCAGGGACCGGTACAACCTGGGCAACCATCTCATGTGCAACAGCAACAGCAAGCCGTGAAACCTGGC
CAGCCTCCTGTCAATGGCTTCTCTGCACCTCAAGCACAGCCTCCTGCACAGGCAAGCATTGGACCTGGCCACAAC
AGAAACAGCTTGTCGAGAGGCGTTGATTCTTCGGCTGCCAGCGAATTCTCGATGCAGTCGCCGGCGCAGCCCCGC
GCCAGAAGTGTCACTGCGAGCCAGATGGACGGCCGACAGTCTGCTCCAGTTGTTGTTGCCACGCCGGAGCAGCCA
GTATCCGACGAATATATTCCTAGAGCGCGCCCGTTGGATACACATGCTGGCTTCGTGCTTGACGCCTTCCAAAAT
TTGACGGCTGAAAGGGAGAGATTTGAGCCCTTTGTGCCGAGCATCAATGATTTAGGAAACGTCGACATCCACACT
CTCACATGTGGCCTTCAGAGTGGTGTTCACGTAGAAGTTCGAGTTGCACTCAACACCTTGGCCACGATTTCCGCA
TCACCCAACCCGGCGCATTTTATACAGCTCAGATTCTGCAGCGACCTGGTTGACGCCTTGGTGGATTGTGCCGAT
CAACAGATTGATCTATTAGCAGAGCACACTGCCGAAGTGTCGGACGAGATCTTGCTTTCATCCTACGAAGACGTG
GTTCGAGCCTGCCGCATCGAGCGCCAGAGCGTCAAAGAAATGCCCATCTTTGGCAGCACCGAGTTCGAGTTGGAC
CATGCTGTCGACCGACTGATAAGCATCACAACCATTATGCGCAATTTATCGTTTCCCGGAGAGCAGAATGGCAAC
CACGACTTTTTAGCAGATGAGTCAGTCATCAAGATGCTCTGCGTCATTATTCGCTATCTCGGCACTCGAACCATG
CTGCTGCGTACGCACATGAATACCCTCGACTTCATGAAGGATGTCGTCGTTTTACTCTCCAACATTGCCGGCTCC
ATAGAAATACCTGGGCGCGAGCAGGCCATGTGTCTGTTGCAATTTCTACTGGCGTTTGCCCCAGCACCTGGCCCT
ATTGCATCCGACGGCACACTCTTCTTCCCGCCATATGAGCCCAGTCTACACCCGTATGCTCCTCATGCCATTGAC
TCACTTGCCAAGCTACTTGCTCGCGACGAGCCAAATCGAGGCTTCTACAGGTCCTTGTTCGCAGCCGATGCTACC
AGCACCCCTGCGTACGACTTGATGACGCGCGCTTTCGCCTTGGCAATATCGCCGATTCCAGACAAGACTCGTGAA
CAGAATCGGTCGTCACTGCAGCCAATGCTCATTGAAACGCGCAAGCCATTTCTCATGCAGGGCTTGCTTGCTGCT
GAAGTGCTCTCATCTCTGGCGCCTGGACCTGAATCGGGCCTGGCCAGGGCCTGGCTGGCATCTGCCAACGACTTG
GCTCACGTTTTGTACCGGCTCGTGCATGATTTAAGCATCATGTATGAGAGACCCCAGATGATTCGAGGCCCAAAC
CGATCCATGGCCAGAAAGGACCCCGAGTTTGTCTACATTGTTGTCGTGGCCGTGGCACTTTTGCGACGGCTTCTG
GAAAAGGCCAAGGATCCCAGCGGCGTGACATGGGCTGTCCCTGGAAACCTACTGCCACACTCGGAAATGCTGCTC
GAGGCCTTGGCCCTGCAAGGTTCCGAGTGGACTCGCGAAGGGATGCTGCCCCAGCTCACGGCGATATTCAATAGT
TCCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail