Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6602
Gene name
LocationContig_61:43678..44232
Strand-
Gene length (bp)554
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12597 Cox20 Cytochrome c oxidase assembly protein COX20 3.1E-35 30 128

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q75D23|COX20_ASHGO Cytochrome c oxidase protein 20, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COX20 PE=3 SV=1 28 154 4.0E-13
sp|Q04935|COX20_YEAST Cytochrome c oxidase protein 20, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX20 PE=1 SV=1 27 154 1.0E-12
sp|G2TRP9|COX20_SCHPO Cytochrome c oxidase protein 20, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox20 PE=3 SV=1 28 135 8.0E-10

GO

GO Term Description Terminal node
GO:0005743 mitochondrial inner membrane Yes
GO:0033617 mitochondrial cytochrome c oxidase assembly Yes
GO:0016043 cellular component organization No
GO:0022607 cellular component assembly No
GO:0065003 protein-containing complex assembly No
GO:0031090 organelle membrane No
GO:0043933 protein-containing complex organization No
GO:0005575 cellular_component No
GO:0017004 cytochrome complex assembly No
GO:0110165 cellular anatomical entity No
GO:0031966 mitochondrial membrane No
GO:0008150 biological_process No
GO:0016020 membrane No
GO:0033108 mitochondrial respiratory chain complex assembly No
GO:0009987 cellular process No
GO:0019866 organelle inner membrane No
GO:0071840 cellular component organization or biogenesis No
GO:0008535 respiratory chain complex IV assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 78 100 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6602
MGSDGDNDSRILDAWAKTAETTAGSNEDRPTLWQALGTITAKDFTNIHNTPCARNGLLIGISSGFIAGSLCFITR
GKLVSATNWAVGVFIGGSVVSFEYCQYQRYAERTRMKRAVETLAELRREDKEKARQKAEEKKRLEEERKAAQKPW
YKVW*
Coding >OphauB2|6602
ATGGGGTCCGACGGAGACAACGACAGCAGGATTTTGGACGCCTGGGCCAAGACCGCTGAGACTACGGCCGGCTCC
AACGAGGATAGGCCAACCCTTTGGCAAGCCCTTGGCACCATAACGGCAAAGGATTTTACCAATATACACAACACA
CCCTGTGCCCGCAACGGCCTGCTTATAGGCATTTCTTCAGGCTTCATCGCTGGTAGTCTCTGCTTCATCACGCGC
GGCAAACTAGTCAGTGCCACCAATTGGGCAGTGGGCGTCTTTATTGGCGGCAGCGTTGTTTCGTTTGAATATTGC
CAATATCAACGATATGCCGAGCGCACACGGATGAAGCGCGCAGTTGAAACGCTTGCAGAGTTGCGTAGAGAAGAC
AAGGAAAAGGCACGTCAAAAGGCCGAGGAGAAGAAGCGTCTCGAGGAAGAGCGCAAGGCTGCCCAGAAGCCCTGG
TACAAGGTGTGGTAG
Transcript >OphauB2|6602
ATGGGGTCCGACGGAGACAACGACAGCAGGATTTTGGACGCCTGGGCCAAGACCGCTGAGACTACGGCCGGCTCC
AACGAGGATAGGCCAACCCTTTGGCAAGCCCTTGGCACCATAACGGCAAAGGATTTTACCAATATACACAACACA
CCCTGTGCCCGCAACGGCCTGCTTATAGGCATTTCTTCAGGCTTCATCGCTGGTAGTCTCTGCTTCATCACGCGC
GGCAAACTAGTCAGTGCCACCAATTGGGCAGTGGGCGTCTTTATTGGCGGCAGCGTTGTTTCGTTTGAATATTGC
CAATATCAACGATATGCCGAGCGCACACGGATGAAGCGCGCAGTTGAAACGCTTGCAGAGTTGCGTAGAGAAGAC
AAGGAAAAGGCACGTCAAAAGGCCGAGGAGAAGAAGCGTCTCGAGGAAGAGCGCAAGGCTGCCCAGAAGCCCTGG
TACAAGGTGTGGTAG
Gene >OphauB2|6602
ATGGGGTCCGACGGAGACAACGACAGCAGGATTTTGGACGCCTGGGCCAAGACCGCTGAGACTACGGCCGGCTCC
AACGAGGATAGGCCAACCCTTTGGCAAGCCCTTGGCACCATAACGGCAAAGGATTTTACCAATATACACAACACA
CCCTGTGCCCGCAACGGCCTGCTTATAGGCATTTCTTCAGGCTTCATCGCTGGTAGTCTCTGCTTCATCACGCGC
GGTTCGTTGCCACTCTGTCAGGCCATGTGACAAAAACAGGAGCTTTGCCTCTGTGAGCCATGACCAAGCTGATGC
AAGTCGAGCCTGTAGGCAAACTAGTCAGTGCCACCAATTGGGCAGTGGGCGTCTTTATTGGCGGCAGCGTTGTTT
CGTTTGAATATTGCCAATATCAACGATATGCCGAGCGCACACGGATGAAGCGCGCAGTTGAAACGCTTGCAGAGT
TGCGTAGAGAAGACAAGGAAAAGGCACGTCAAAAGGCCGAGGAGAAGAAGCGTCTCGAGGAAGAGCGCAAGGCTG
CCCAGAAGCCCTGGTACAAGGTGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail