Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6596
Gene name
LocationContig_61:32038..33302
Strand-
Gene length (bp)1264
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07986 TBCC Tubulin binding cofactor C 6.5E-26 197 310
PF16752 TBCC_N Tubulin-specific chaperone C N-terminal domain 6.4E-10 3 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SMR2|TBCC_ARATH Tubulin-folding cofactor C OS=Arabidopsis thaliana GN=TFCC PE=1 SV=1 197 330 2.0E-20
sp|Q15814|TBCC_HUMAN Tubulin-specific chaperone C OS=Homo sapiens GN=TBCC PE=1 SV=2 2 329 2.0E-16
sp|Q3SZE9|TBCC_BOVIN Tubulin-specific chaperone C OS=Bos taurus GN=TBCC PE=2 SV=1 33 329 2.0E-16
sp|Q5R5J7|TBCC_PONAB Tubulin-specific chaperone C OS=Pongo abelii GN=TBCC PE=2 SV=1 2 329 1.0E-15
sp|Q8VCN9|TBCC_MOUSE Tubulin-specific chaperone C OS=Mus musculus GN=Tbcc PE=1 SV=1 22 329 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SMR2|TBCC_ARATH Tubulin-folding cofactor C OS=Arabidopsis thaliana GN=TFCC PE=1 SV=1 197 330 2.0E-20
sp|Q15814|TBCC_HUMAN Tubulin-specific chaperone C OS=Homo sapiens GN=TBCC PE=1 SV=2 2 329 2.0E-16
sp|Q3SZE9|TBCC_BOVIN Tubulin-specific chaperone C OS=Bos taurus GN=TBCC PE=2 SV=1 33 329 2.0E-16
sp|Q5R5J7|TBCC_PONAB Tubulin-specific chaperone C OS=Pongo abelii GN=TBCC PE=2 SV=1 2 329 1.0E-15
sp|Q8VCN9|TBCC_MOUSE Tubulin-specific chaperone C OS=Mus musculus GN=Tbcc PE=1 SV=1 22 329 2.0E-15
sp|Q9EPK2|XRP2_MOUSE Protein XRP2 OS=Mus musculus GN=Rp2 PE=1 SV=3 219 347 2.0E-08
sp|Q8AVX5|XRP2_XENLA Protein XRP2 OS=Xenopus laevis GN=rp2 PE=2 SV=3 219 325 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0015631 tubulin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6596
MDSSQSFYRSFQDKVAAIEGQIAQLESAPAAGGQRQDAIDRVLVLIANLQNDVADAAESTPSYDRRQYAEGIRTL
HDKVNEAVARVTPKSRFQFKRPAAKVGGVASASSDTDARLHRLGASRQHDAVAAAATTTDDNDDTAHKSHVEKDY
NKDLASHGASCVRRPSFSAAKIISISEQKDLHIILPPLTAQATASGSLTGLRSCIVDMSQATANTKSFAGLALKD
ISKSLLVTGRVNGPVHITGVCNSILVVVARQVRIHECRGVDIYLHCSSHPIIEDCTEMRFAPLPPCLSGDAESAT
ENQWDQVDDFKWLKTGHSPNWSILPETQQVGNDVWIKMLQSPANVSVEKTLSQIGLPS*
Coding >OphauB2|6596
ATGGACTCGAGCCAGAGCTTCTACAGAAGCTTCCAAGACAAGGTCGCTGCCATTGAGGGGCAGATTGCGCAGCTC
GAGTCGGCACCTGCTGCTGGCGGCCAGCGACAAGACGCCATCGACAGAGTCTTGGTCCTGATTGCCAATCTGCAA
AACGACGTGGCCGACGCTGCCGAGTCGACGCCCTCGTACGACCGCCGACAGTATGCCGAGGGCATCAGGACCCTA
CATGACAAAGTCAACGAGGCCGTCGCTAGAGTCACGCCCAAGTCACGCTTTCAATTCAAACGCCCAGCGGCAAAG
GTGGGTGGTGTTGCCTCGGCATCGTCGGATACGGATGCGCGTCTCCATCGTCTAGGCGCGTCACGCCAACACGAT
GCTGTTGCGGCGGCGGCGACGACGACTGACGACAATGACGACACTGCACACAAGAGTCACGTAGAAAAGGACTAC
AACAAGGACCTGGCTAGCCATGGCGCGTCGTGCGTGCGCAGACCCAGCTTCTCGGCAGCAAAAATTATTTCGATT
TCAGAGCAAAAGGACCTGCATATAATCCTGCCTCCTTTGACCGCCCAAGCCACAGCGTCCGGCAGTCTCACAGGC
CTGCGCAGCTGCATAGTCGACATGTCGCAAGCAACAGCCAACACAAAGTCCTTTGCAGGGCTTGCGCTCAAGGAC
ATTTCCAAAAGCCTCCTTGTTACCGGTCGCGTCAATGGGCCGGTGCACATTACCGGAGTCTGCAACAGCATTCTC
GTCGTCGTTGCTCGGCAGGTGCGGATTCACGAGTGTAGAGGCGTCGATATTTACTTGCATTGCAGTAGCCACCCC
ATCATTGAAGATTGCACCGAGATGCGCTTTGCGCCACTGCCACCCTGCCTTTCAGGCGACGCAGAGTCGGCCACG
GAGAACCAATGGGACCAGGTAGACGACTTCAAGTGGCTCAAAACAGGCCACAGTCCCAATTGGTCCATTCTCCCC
GAGACGCAACAGGTGGGCAATGACGTTTGGATAAAGATGCTGCAAAGCCCGGCAAATGTAAGCGTCGAAAAGACT
CTCAGTCAAATCGGGCTGCCGTCATAG
Transcript >OphauB2|6596
ATGGACTCGAGCCAGAGCTTCTACAGAAGCTTCCAAGACAAGGTCGCTGCCATTGAGGGGCAGATTGCGCAGCTC
GAGTCGGCACCTGCTGCTGGCGGCCAGCGACAAGACGCCATCGACAGAGTCTTGGTCCTGATTGCCAATCTGCAA
AACGACGTGGCCGACGCTGCCGAGTCGACGCCCTCGTACGACCGCCGACAGTATGCCGAGGGCATCAGGACCCTA
CATGACAAAGTCAACGAGGCCGTCGCTAGAGTCACGCCCAAGTCACGCTTTCAATTCAAACGCCCAGCGGCAAAG
GTGGGTGGTGTTGCCTCGGCATCGTCGGATACGGATGCGCGTCTCCATCGTCTAGGCGCGTCACGCCAACACGAT
GCTGTTGCGGCGGCGGCGACGACGACTGACGACAATGACGACACTGCACACAAGAGTCACGTAGAAAAGGACTAC
AACAAGGACCTGGCTAGCCATGGCGCGTCGTGCGTGCGCAGACCCAGCTTCTCGGCAGCAAAAATTATTTCGATT
TCAGAGCAAAAGGACCTGCATATAATCCTGCCTCCTTTGACCGCCCAAGCCACAGCGTCCGGCAGTCTCACAGGC
CTGCGCAGCTGCATAGTCGACATGTCGCAAGCAACAGCCAACACAAAGTCCTTTGCAGGGCTTGCGCTCAAGGAC
ATTTCCAAAAGCCTCCTTGTTACCGGTCGCGTCAATGGGCCGGTGCACATTACCGGAGTCTGCAACAGCATTCTC
GTCGTCGTTGCTCGGCAGGTGCGGATTCACGAGTGTAGAGGCGTCGATATTTACTTGCATTGCAGTAGCCACCCC
ATCATTGAAGATTGCACCGAGATGCGCTTTGCGCCACTGCCACCCTGCCTTTCAGGCGACGCAGAGTCGGCCACG
GAGAACCAATGGGACCAGGTAGACGACTTCAAGTGGCTCAAAACAGGCCACAGTCCCAATTGGTCCATTCTCCCC
GAGACGCAACAGGTGGGCAATGACGTTTGGATAAAGATGCTGCAAAGCCCGGCAAATGTAAGCGTCGAAAAGACT
CTCAGTCAAATCGGGCTGCCGTCATAG
Gene >OphauB2|6596
ATGGACTCGAGCCAGAGCTTCTACAGAAGCTTCCAAGACAAGGTCGCTGGTAGGTGGGCGCAGGCGAGCCATTTC
TCCATGCTCTGTTGCTGACCCAGTCTTGCTCCTGCTCAGCCATTGAGGGGCAGATTGCGCAGCTCGAGTCGGCAC
CTGCTGCTGGCGGCCAGCGACAAGACGCCATCGACAGAGTCTTGGTCCTGATTGCCAATCTGCAAAACGACGTGG
CCGACGCTGCCGAGTCGACGCCCTCGTACGACCGCCGACAGTATGCCGAGGTTTGATCTTGGTCCTGCTCGCCCA
TCAGGGTGGTTGCATCTAACGGGAGCAGGGCATCAGGACCCTACATGACAAAGTCAACGAGGCCGTCGCTAGAGT
CACGCCCAAGTCACGCTTTCAATTCAAACGCCCAGCGGCAAAGGTGGGTGGTGTTGCCTCGGCATCGTCGGATAC
GGATGCGCGTCTCCATCGTCTAGGCGCGTCACGCCAACACGATGCTGTTGCGGCGGCGGCGACGACGACTGACGA
CAATGACGACACTGCACACAAGAGTCACGTAGAAAAGGACTACAACAAGGACCTGGCTAGCCATGGCGCGTCGTG
CGTGCGCAGACCCAGCTTCTCGGCAGCAAAAATTATTTCGATTTCAGAGCAAAAGGACCTGCATATAATCCTGCC
TCCTTTGACCGCCCAAGCCACAGCGTCCGGCAGTCTCACAGGCCTGCGCAGCTGCATAGTCGACATGTCGCAAGC
AACAGCCAACACAAAGTCCTTTGCAGGGCTTGCGCTCAAGGACATTTCCAAAAGCCTCCTTGTTACCGGTCGCGT
CAATGGGCCGGTGCACATTACCGGAGTCTGCAACAGCATTCTCGTCGTCGTTGCTCGGCAGGTGCGGATTCACGA
GTGTAGAGGCGTCGATATTTACTTGCATTGCAGTAGCCACCCCATCATTGAAGATTGCACCGAGATGCGCTTTGC
GCCACTGCCACCCTGCCTTGTAAGTAGAGTAGCAGTGTGTTTTGCATGCCGTGGCCGAGTCGGTACAGCTAACGA
CGCAAATGAGCAGTCAGGCGACGCAGAGTCGGCCACGGAGAACCAATGGGACCAGGTAGACGACTTCAAGTGGCT
CAAAACAGGCCACAGTCCCAATTGGTCCATTCTCCCCGAGACGCAACAGGTGGGCAATGACGTTTGGATAAAGAT
GCTGCAAAGCCCGGCAAATGTAAGCGTCGAAAAGACTCTCAGTCAAATCGGGCTGCCGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail