Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6593
Gene name
LocationContig_61:22390..25383
Strand-
Gene length (bp)2993
Transcript length (bp)2934
Coding sequence length (bp)2934
Protein length (aa) 978

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09421 FRQ Frequency clock protein 0.0E+00 18 975

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00586|FRQ_TRISN Frequency clock protein OS=Trichoderma spinulosum GN=FRQ PE=3 SV=1 18 975 0.0E+00
sp|Q01115|FRQ_LEPAU Frequency clock protein OS=Leptosphaeria australiensis GN=FRQ PE=3 SV=1 24 929 0.0E+00
sp|Q09033|FRQ_SORFI Frequency clock protein OS=Sordaria fimicola GN=FRQ PE=3 SV=1 7 908 0.0E+00
sp|P19970|FRQ_NEUCR Frequency clock protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=frq PE=1 SV=3 7 908 0.0E+00

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0005737 cytoplasm Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0007623 circadian rhythm Yes
GO:0031323 regulation of cellular metabolic process No
GO:0048511 rhythmic process No
GO:0005575 cellular_component No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0050789 regulation of biological process No
GO:0043226 organelle No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0065007 biological regulation No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043227 membrane-bounded organelle No
GO:0050794 regulation of cellular process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0043229 intracellular organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2075
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2740
Ophiocordyceps australis map64 (Brazil) OphauB2|6593 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05194
Ophiocordyceps camponoti-rufipedis Ophun1|5099
Ophiocordyceps kimflemingae Ophio5|6046
Ophiocordyceps subramaniannii Hirsu2|240

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6593
MPITTDNQTTSLQPPPRPTQRITHPLPRRSSPANSVTLRHHRLTREACLRANQSLAAYNCNNVTTSPRRNSSGDS
HETGQSDPKNWFDQSNQNPTATYDTDANAMDVDPPFFQKESDSSNEDKVDSFQMLPIQPKLTVAHSSSADDYRSV
IDDLTIEIQKLKDELKRYKQKGPDLLRKDKLFEIKIHGLPNRKKRELEATLREFAASLGDSPNTTTTRRQGDAKH
ANRDHMYSGAGSASKHASSSSGSNARPVDSAYASMSTGANSSMGTSLSRPPLSSRKKSAEQKVENYLRDIPEGLY
PRHMSMSEKERKKMVVRRLEQLFTGKIGGRHMKRSQHAPPPRAGTSVPLVSASAQSCPLAPQPPAPVSNEPSREA
KILSTDQQSGQSTKNGGSRDLASAANSNEEQTDLAGNGRTTNTGSNKSPPMVPPPAEQRPTRLKDLDPDRVQVPS
ENMEYIRHLGLVPPEILADQKARTSMNVCTDADGWVYLNLLCNLAQLHMINVTPSFVRSAVCEMSTMFQLSPDGR
RIRWRGGDEGTRFTSDSSGDNSQRSPDTDDTSSSNIETSRKRQKTNNSIGVRSGSSGKNPYKFGPQVYNSSSGFH
YKPLFAQHEMLIGQPSPEETLSSFGPAEGSGQDVSRWDHSGSGTSNRRKRRHDGAIIYYSGAPFCTDLSGDPGDV
SPTTYMLSSGQEQPETKQVDTRPRPHRSESGSSLCYRPLIDTSAVRANLRIDTDDGDAIPELVTDSGDDSGDADI
DLCWTHEQQYIDALAMEPTGLGGVLPEDHFMVVVTTKRPKLESQSRASSVERDNANVNEDSLASHAATTITTTEP
PSGLPSKGETLGSNNASLLRIEYISGRIKRLPPVSLPPPALFLPPFSSDGSSDGDETDCEETDCDDESSEARISR
KVNPHSSDGYPDGVDLSSGDEDGEDPDDEPNTDRMYARSGGPSKANQLDIDGAGHSISSAEAAPGTHRGCSKSAS
DA*
Coding >OphauB2|6593
ATGCCTATCACCACCGACAACCAGACGACCAGCTTACAACCCCCACCCCGGCCAACTCAACGCATCACACATCCG
CTTCCGCGCCGATCCTCGCCGGCCAATTCGGTGACCCTGCGACACCATCGCCTTACCCGCGAAGCTTGCCTACGA
GCCAACCAGAGTTTGGCTGCTTATAATTGCAACAATGTCACCACTTCCCCACGTCGAAACTCGTCGGGCGACAGC
CACGAGACGGGTCAAAGCGACCCCAAGAATTGGTTTGACCAGTCAAACCAAAATCCCACAGCAACATATGACACT
GACGCTAATGCCATGGATGTTGACCCGCCCTTTTTTCAAAAAGAATCGGATTCGTCAAATGAAGACAAAGTCGAC
TCTTTCCAGATGTTGCCTATACAGCCAAAACTCACAGTCGCACATAGTAGTAGCGCCGACGATTATCGCAGCGTC
ATTGACGACTTGACCATAGAAATTCAAAAGCTCAAGGACGAACTCAAACGATATAAGCAAAAGGGCCCTGACCTG
CTGCGCAAGGATAAACTCTTTGAGATTAAGATTCACGGGCTCCCTAATCGCAAGAAGAGAGAGTTGGAAGCCACT
CTTCGCGAATTTGCCGCCAGCCTTGGCGACTCCCCCAACACCACTACAACACGTCGACAGGGTGACGCCAAGCAC
GCCAATCGCGATCACATGTATTCTGGGGCTGGATCTGCCTCCAAGCACGCATCATCGTCGTCGGGATCAAACGCC
AGGCCCGTCGACTCGGCATATGCTTCCATGTCTACAGGGGCTAATTCATCCATGGGTACTTCTCTAAGCAGGCCA
CCCCTGAGTTCTAGGAAAAAGTCGGCGGAACAAAAGGTGGAAAATTACTTGCGCGACATTCCTGAAGGCCTCTAT
CCACGTCATATGAGCATGTCGGAAAAGGAGAGGAAGAAGATGGTGGTGCGGCGTCTTGAGCAGCTCTTCACAGGC
AAGATTGGTGGACGACACATGAAGCGTTCCCAGCATGCACCACCACCTCGGGCTGGAACTTCTGTGCCCTTGGTG
TCGGCATCGGCTCAAAGTTGTCCACTGGCTCCCCAGCCGCCAGCGCCCGTGTCAAATGAGCCTTCACGTGAGGCT
AAGATTTTGTCGACTGACCAGCAGTCGGGCCAGTCAACCAAGAACGGTGGTTCACGAGACTTGGCGTCTGCCGCA
AATTCGAATGAGGAACAAACGGACTTGGCAGGCAATGGTCGTACCACTAATACTGGTTCAAACAAGTCGCCGCCA
ATGGTGCCGCCGCCAGCCGAACAACGTCCCACACGCCTCAAGGATCTCGATCCAGATCGTGTTCAGGTACCATCT
GAGAACATGGAGTACATTCGACACCTGGGTCTCGTACCACCTGAGATTCTAGCTGATCAAAAGGCGCGGACCTCG
ATGAATGTGTGTACTGATGCCGATGGCTGGGTCTATCTCAACCTGCTCTGCAACCTTGCACAGCTTCACATGATC
AATGTGACGCCAAGCTTTGTGCGATCGGCTGTGTGTGAGATGAGCACCATGTTCCAGCTGTCTCCAGATGGACGC
CGAATTCGCTGGAGAGGTGGCGATGAAGGCACAAGATTTACGAGCGATAGCTCTGGCGACAATTCGCAGAGGAGT
CCTGATACGGATGATACCAGTAGCAGCAATATCGAAACATCTCGCAAGAGGCAAAAGACGAACAACTCGATTGGT
GTTCGCTCTGGCAGCTCTGGCAAGAATCCATACAAATTTGGACCACAAGTGTACAATTCTTCGAGTGGCTTTCAT
TACAAGCCTCTGTTTGCTCAGCATGAGATGCTCATTGGACAACCGTCGCCCGAGGAAACCCTGTCGTCGTTTGGC
CCAGCCGAAGGCAGCGGCCAGGATGTTTCTCGCTGGGATCACAGTGGCTCAGGAACGTCTAACCGACGGAAGCGA
CGTCACGACGGAGCAATCATTTATTATAGCGGCGCGCCCTTTTGCACTGATTTGTCGGGAGATCCCGGCGATGTC
TCACCTACGACATATATGCTATCCAGTGGCCAGGAGCAGCCAGAAACAAAGCAGGTGGATACTCGGCCTCGTCCG
CACCGGTCAGAGTCGGGGTCGTCGCTCTGCTATCGGCCCTTGATTGACACGTCTGCTGTTCGCGCCAATCTACGC
ATTGACACTGATGATGGCGACGCGATTCCAGAGCTTGTGACTGACTCGGGAGACGACTCTGGAGATGCCGACATT
GACTTGTGCTGGACTCACGAACAGCAATACATTGACGCTCTCGCCATGGAACCGACTGGGCTAGGTGGCGTTTTG
CCGGAAGACCACTTTATGGTTGTTGTTACGACAAAGCGACCCAAGTTGGAATCGCAATCTAGGGCATCGTCAGTG
GAGCGTGACAATGCGAATGTAAATGAGGACAGTCTTGCAAGTCATGCTGCAACTACAATTACAACTACAGAGCCG
CCATCTGGTCTTCCATCCAAGGGAGAGACTCTGGGCTCAAACAATGCTTCTTTGCTTCGAATCGAGTACATTTCG
GGCCGCATCAAGCGTCTGCCACCAGTTTCTCTGCCGCCTCCAGCCCTCTTTCTTCCTCCGTTTAGCTCTGATGGG
TCGAGCGACGGCGACGAGACGGACTGTGAGGAGACGGACTGCGACGACGAATCCTCAGAGGCGAGGATTAGCCGC
AAGGTTAACCCGCATTCTTCCGACGGCTATCCCGACGGCGTCGACTTGAGCAGCGGCGACGAGGATGGTGAAGAT
CCTGATGACGAGCCAAATACGGACCGCATGTACGCGAGAAGTGGCGGCCCCAGCAAAGCCAACCAGCTGGACATT
GATGGCGCCGGTCACTCCATTTCTAGTGCCGAAGCGGCGCCAGGGACTCATCGCGGATGCAGCAAGAGTGCGAGT
GATGCTTGA
Transcript >OphauB2|6593
ATGCCTATCACCACCGACAACCAGACGACCAGCTTACAACCCCCACCCCGGCCAACTCAACGCATCACACATCCG
CTTCCGCGCCGATCCTCGCCGGCCAATTCGGTGACCCTGCGACACCATCGCCTTACCCGCGAAGCTTGCCTACGA
GCCAACCAGAGTTTGGCTGCTTATAATTGCAACAATGTCACCACTTCCCCACGTCGAAACTCGTCGGGCGACAGC
CACGAGACGGGTCAAAGCGACCCCAAGAATTGGTTTGACCAGTCAAACCAAAATCCCACAGCAACATATGACACT
GACGCTAATGCCATGGATGTTGACCCGCCCTTTTTTCAAAAAGAATCGGATTCGTCAAATGAAGACAAAGTCGAC
TCTTTCCAGATGTTGCCTATACAGCCAAAACTCACAGTCGCACATAGTAGTAGCGCCGACGATTATCGCAGCGTC
ATTGACGACTTGACCATAGAAATTCAAAAGCTCAAGGACGAACTCAAACGATATAAGCAAAAGGGCCCTGACCTG
CTGCGCAAGGATAAACTCTTTGAGATTAAGATTCACGGGCTCCCTAATCGCAAGAAGAGAGAGTTGGAAGCCACT
CTTCGCGAATTTGCCGCCAGCCTTGGCGACTCCCCCAACACCACTACAACACGTCGACAGGGTGACGCCAAGCAC
GCCAATCGCGATCACATGTATTCTGGGGCTGGATCTGCCTCCAAGCACGCATCATCGTCGTCGGGATCAAACGCC
AGGCCCGTCGACTCGGCATATGCTTCCATGTCTACAGGGGCTAATTCATCCATGGGTACTTCTCTAAGCAGGCCA
CCCCTGAGTTCTAGGAAAAAGTCGGCGGAACAAAAGGTGGAAAATTACTTGCGCGACATTCCTGAAGGCCTCTAT
CCACGTCATATGAGCATGTCGGAAAAGGAGAGGAAGAAGATGGTGGTGCGGCGTCTTGAGCAGCTCTTCACAGGC
AAGATTGGTGGACGACACATGAAGCGTTCCCAGCATGCACCACCACCTCGGGCTGGAACTTCTGTGCCCTTGGTG
TCGGCATCGGCTCAAAGTTGTCCACTGGCTCCCCAGCCGCCAGCGCCCGTGTCAAATGAGCCTTCACGTGAGGCT
AAGATTTTGTCGACTGACCAGCAGTCGGGCCAGTCAACCAAGAACGGTGGTTCACGAGACTTGGCGTCTGCCGCA
AATTCGAATGAGGAACAAACGGACTTGGCAGGCAATGGTCGTACCACTAATACTGGTTCAAACAAGTCGCCGCCA
ATGGTGCCGCCGCCAGCCGAACAACGTCCCACACGCCTCAAGGATCTCGATCCAGATCGTGTTCAGGTACCATCT
GAGAACATGGAGTACATTCGACACCTGGGTCTCGTACCACCTGAGATTCTAGCTGATCAAAAGGCGCGGACCTCG
ATGAATGTGTGTACTGATGCCGATGGCTGGGTCTATCTCAACCTGCTCTGCAACCTTGCACAGCTTCACATGATC
AATGTGACGCCAAGCTTTGTGCGATCGGCTGTGTGTGAGATGAGCACCATGTTCCAGCTGTCTCCAGATGGACGC
CGAATTCGCTGGAGAGGTGGCGATGAAGGCACAAGATTTACGAGCGATAGCTCTGGCGACAATTCGCAGAGGAGT
CCTGATACGGATGATACCAGTAGCAGCAATATCGAAACATCTCGCAAGAGGCAAAAGACGAACAACTCGATTGGT
GTTCGCTCTGGCAGCTCTGGCAAGAATCCATACAAATTTGGACCACAAGTGTACAATTCTTCGAGTGGCTTTCAT
TACAAGCCTCTGTTTGCTCAGCATGAGATGCTCATTGGACAACCGTCGCCCGAGGAAACCCTGTCGTCGTTTGGC
CCAGCCGAAGGCAGCGGCCAGGATGTTTCTCGCTGGGATCACAGTGGCTCAGGAACGTCTAACCGACGGAAGCGA
CGTCACGACGGAGCAATCATTTATTATAGCGGCGCGCCCTTTTGCACTGATTTGTCGGGAGATCCCGGCGATGTC
TCACCTACGACATATATGCTATCCAGTGGCCAGGAGCAGCCAGAAACAAAGCAGGTGGATACTCGGCCTCGTCCG
CACCGGTCAGAGTCGGGGTCGTCGCTCTGCTATCGGCCCTTGATTGACACGTCTGCTGTTCGCGCCAATCTACGC
ATTGACACTGATGATGGCGACGCGATTCCAGAGCTTGTGACTGACTCGGGAGACGACTCTGGAGATGCCGACATT
GACTTGTGCTGGACTCACGAACAGCAATACATTGACGCTCTCGCCATGGAACCGACTGGGCTAGGTGGCGTTTTG
CCGGAAGACCACTTTATGGTTGTTGTTACGACAAAGCGACCCAAGTTGGAATCGCAATCTAGGGCATCGTCAGTG
GAGCGTGACAATGCGAATGTAAATGAGGACAGTCTTGCAAGTCATGCTGCAACTACAATTACAACTACAGAGCCG
CCATCTGGTCTTCCATCCAAGGGAGAGACTCTGGGCTCAAACAATGCTTCTTTGCTTCGAATCGAGTACATTTCG
GGCCGCATCAAGCGTCTGCCACCAGTTTCTCTGCCGCCTCCAGCCCTCTTTCTTCCTCCGTTTAGCTCTGATGGG
TCGAGCGACGGCGACGAGACGGACTGTGAGGAGACGGACTGCGACGACGAATCCTCAGAGGCGAGGATTAGCCGC
AAGGTTAACCCGCATTCTTCCGACGGCTATCCCGACGGCGTCGACTTGAGCAGCGGCGACGAGGATGGTGAAGAT
CCTGATGACGAGCCAAATACGGACCGCATGTACGCGAGAAGTGGCGGCCCCAGCAAAGCCAACCAGCTGGACATT
GATGGCGCCGGTCACTCCATTTCTAGTGCCGAAGCGGCGCCAGGGACTCATCGCGGATGCAGCAAGAGTGCGAGT
GATGCTTGA
Gene >OphauB2|6593
ATGCCTATCACCACCGACAACCAGACGACCAGCTTACAACCCCCACCCCGGCCAACTCAACGCATCACACATCCG
CTTCCGCGCCGATCCTCGCCGGCCAATTCGGTGACCCTGCGACACCATCGCCTTACCCGCGAAGCTTGCCTACGA
GCCAACCAGAGTTTGGCTGCTTATAATTGCAACAATGTCACCACTTCCCCACGTCGAAACTCGTCGGGCGACAGC
CACGAGACGGGTCAAAGCGACCCCAAGAATTGGTTTGACCAGTCAAACCAAAATCCCACAGCAACATATGACACT
GACGCTAATGCCATGGATGGTAAGCGCAATCACAACTTTTATTCCGAAGCGCCTCGGGACTAATGTTTGGTGCAA
CAGTTGACCCGCCCTTTTTTCAAAAAGAATCGGATTCGTCAAATGAAGACAAAGTCGACTCTTTCCAGATGTTGC
CTATACAGCCAAAACTCACAGTCGCACATAGTAGTAGCGCCGACGATTATCGCAGCGTCATTGACGACTTGACCA
TAGAAATTCAAAAGCTCAAGGACGAACTCAAACGATATAAGCAAAAGGGCCCTGACCTGCTGCGCAAGGATAAAC
TCTTTGAGATTAAGATTCACGGGCTCCCTAATCGCAAGAAGAGAGAGTTGGAAGCCACTCTTCGCGAATTTGCCG
CCAGCCTTGGCGACTCCCCCAACACCACTACAACACGTCGACAGGGTGACGCCAAGCACGCCAATCGCGATCACA
TGTATTCTGGGGCTGGATCTGCCTCCAAGCACGCATCATCGTCGTCGGGATCAAACGCCAGGCCCGTCGACTCGG
CATATGCTTCCATGTCTACAGGGGCTAATTCATCCATGGGTACTTCTCTAAGCAGGCCACCCCTGAGTTCTAGGA
AAAAGTCGGCGGAACAAAAGGTGGAAAATTACTTGCGCGACATTCCTGAAGGCCTCTATCCACGTCATATGAGCA
TGTCGGAAAAGGAGAGGAAGAAGATGGTGGTGCGGCGTCTTGAGCAGCTCTTCACAGGCAAGATTGGTGGACGAC
ACATGAAGCGTTCCCAGCATGCACCACCACCTCGGGCTGGAACTTCTGTGCCCTTGGTGTCGGCATCGGCTCAAA
GTTGTCCACTGGCTCCCCAGCCGCCAGCGCCCGTGTCAAATGAGCCTTCACGTGAGGCTAAGATTTTGTCGACTG
ACCAGCAGTCGGGCCAGTCAACCAAGAACGGTGGTTCACGAGACTTGGCGTCTGCCGCAAATTCGAATGAGGAAC
AAACGGACTTGGCAGGCAATGGTCGTACCACTAATACTGGTTCAAACAAGTCGCCGCCAATGGTGCCGCCGCCAG
CCGAACAACGTCCCACACGCCTCAAGGATCTCGATCCAGATCGTGTTCAGGTACCATCTGAGAACATGGAGTACA
TTCGACACCTGGGTCTCGTACCACCTGAGATTCTAGCTGATCAAAAGGCGCGGACCTCGATGAATGTGTGTACTG
ATGCCGATGGCTGGGTCTATCTCAACCTGCTCTGCAACCTTGCACAGCTTCACATGATCAATGTGACGCCAAGCT
TTGTGCGATCGGCTGTGTGTGAGATGAGCACCATGTTCCAGCTGTCTCCAGATGGACGCCGAATTCGCTGGAGAG
GTGGCGATGAAGGCACAAGATTTACGAGCGATAGCTCTGGCGACAATTCGCAGAGGAGTCCTGATACGGATGATA
CCAGTAGCAGCAATATCGAAACATCTCGCAAGAGGCAAAAGACGAACAACTCGATTGGTGTTCGCTCTGGCAGCT
CTGGCAAGAATCCATACAAATTTGGACCACAAGTGTACAATTCTTCGAGTGGCTTTCATTACAAGCCTCTGTTTG
CTCAGCATGAGATGCTCATTGGACAACCGTCGCCCGAGGAAACCCTGTCGTCGTTTGGCCCAGCCGAAGGCAGCG
GCCAGGATGTTTCTCGCTGGGATCACAGTGGCTCAGGAACGTCTAACCGACGGAAGCGACGTCACGACGGAGCAA
TCATTTATTATAGCGGCGCGCCCTTTTGCACTGATTTGTCGGGAGATCCCGGCGATGTCTCACCTACGACATATA
TGCTATCCAGTGGCCAGGAGCAGCCAGAAACAAAGCAGGTGGATACTCGGCCTCGTCCGCACCGGTCAGAGTCGG
GGTCGTCGCTCTGCTATCGGCCCTTGATTGACACGTCTGCTGTTCGCGCCAATCTACGCATTGACACTGATGATG
GCGACGCGATTCCAGAGCTTGTGACTGACTCGGGAGACGACTCTGGAGATGCCGACATTGACTTGTGCTGGACTC
ACGAACAGCAATACATTGACGCTCTCGCCATGGAACCGACTGGGCTAGGTGGCGTTTTGCCGGAAGACCACTTTA
TGGTTGTTGTTACGACAAAGCGACCCAAGTTGGAATCGCAATCTAGGGCATCGTCAGTGGAGCGTGACAATGCGA
ATGTAAATGAGGACAGTCTTGCAAGTCATGCTGCAACTACAATTACAACTACAGAGCCGCCATCTGGTCTTCCAT
CCAAGGGAGAGACTCTGGGCTCAAACAATGCTTCTTTGCTTCGAATCGAGTACATTTCGGGCCGCATCAAGCGTC
TGCCACCAGTTTCTCTGCCGCCTCCAGCCCTCTTTCTTCCTCCGTTTAGCTCTGATGGGTCGAGCGACGGCGACG
AGACGGACTGTGAGGAGACGGACTGCGACGACGAATCCTCAGAGGCGAGGATTAGCCGCAAGGTTAACCCGCATT
CTTCCGACGGCTATCCCGACGGCGTCGACTTGAGCAGCGGCGACGAGGATGGTGAAGATCCTGATGACGAGCCAA
ATACGGACCGCATGTACGCGAGAAGTGGCGGCCCCAGCAAAGCCAACCAGCTGGACATTGATGGCGCCGGTCACT
CCATTTCTAGTGCCGAAGCGGCGCCAGGGACTCATCGCGGATGCAGCAAGAGTGCGAGTGATGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail