Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6591
Gene name
LocationContig_61:16768..19487
Strand-
Gene length (bp)2719
Transcript length (bp)2472
Coding sequence length (bp)2472
Protein length (aa) 824

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08553 VID27 VID27 C-terminal WD40-like domain 1.4E-184 437 788
PF17748 VID27_N VID27 N-terminal region 9.1E-73 1 175
PF17747 VID27_PH VID27 PH-like domain 3.4E-37 255 361

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR3|VID27_SCHPO Vacuolar import and degradation protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vid27 PE=1 SV=1 1 823 0.0E+00
sp|P40157|VID27_YEAST Vacuolar import and degradation protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VID27 PE=1 SV=1 6 787 2.0E-142
sp|Q555V7|VID27_DICDI VID27-like protein OS=Dictyostelium discoideum GN=DDB_G0274813 PE=3 SV=1 438 776 1.0E-60
sp|P40781|CYPR4_CYNCA Protein CYPRO4 OS=Cynara cardunculus GN=CYPRO4 PE=2 SV=1 486 751 4.0E-24

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6591
MFVLRNVGKLLFGSAAQESIIDIPQGQLYLVRPLSPKGYSELIFRDATIRIRRTNQDFHYQLVVQRVFEEGEAEL
LADEEGDDLEVDALAAERDEKTFLLDEALCLRVDARHDGEKVLAWKDLSGDTGDVYEFVCDSLVSAVQVQQFIET
ARHCQYERKYRKPHTTASEVDLKHFDFEDIDYPIPPASPLHSPSLTRSIDFGSVDHIEDMPTPKKAASSAAQREM
AVVPTREPDNEPSEQQSQLTALDSPPPPLEIYATVSAELHIFQPQPGHFTLVDDSVIATISEVGKWEYWLQVDGK
GKSWLGTPLVADINPVFDFEYLSFVFNYFGKDGTARSWLLRFKDQPTLETAQRAVLQAIWERLNETKWAKIQEKE
REYVLDSFADLAMEDAPENQEEEEEEEDESPADDEDDKGVHSEGYDSDDDEHAEQERNQGEVNSQLAVGYKHDRS
FVVRGSKIGVFSHTDDNRLKFATNISKVTTPGGKLMSPKKVMLHSEDRDLIMQNKIDPNKLYRMDIEYGKVVDEW
NVHDDVPVVNFAPENKFAQMTAEQTFLGISNNALYRIDPRLSGNKLVDTDMKQYASKNDFSALATTEKGYIAVAS
NKGDIRLFDRLGIRAKTQLPALGDPIIGMDVSANGRWILGTTKNYLLLIDAQQRGGKNDGRLGFERAFSADTKPH
PRRLGLTPEHVAQFHYETGKPVCFTPAKFNTGAAGTEETSIITATGPYIIEWNLKRLLRSPKGAYKIKRYQEDVQ
ADDFKFGSDKNVIVALPNEVNMVAKQSLRRPTRQSLLGEGLDGGGARQSLGRIGTRDSGRYKLGKNDVVNAPY*
Coding >OphauB2|6591
ATGTTTGTTCTACGCAACGTCGGCAAGCTGCTCTTCGGCTCTGCAGCCCAGGAATCCATCATCGATATCCCCCAA
GGACAGCTTTACTTGGTCCGCCCGCTATCGCCCAAGGGCTACTCAGAGCTCATTTTTAGAGACGCCACGATTCGC
ATCCGTCGCACAAACCAAGACTTTCATTATCAGCTCGTTGTACAGCGCGTCTTTGAAGAAGGCGAGGCTGAGCTA
CTCGCCGACGAAGAAGGCGACGATTTGGAGGTGGATGCTCTGGCGGCGGAGCGGGACGAAAAGACATTTCTACTC
GACGAGGCCTTGTGCTTGCGGGTCGACGCCAGGCACGACGGCGAAAAGGTTCTTGCTTGGAAGGATCTAAGTGGC
GATACGGGCGACGTTTACGAATTCGTTTGCGATAGTCTAGTCTCGGCTGTCCAGGTGCAACAATTTATTGAGACT
GCTCGCCACTGTCAGTACGAGCGCAAATACCGCAAGCCGCATACCACGGCTTCCGAAGTCGATCTCAAACACTTT
GACTTTGAAGACATTGATTACCCGATTCCGCCCGCGAGCCCCCTCCACAGCCCCTCACTTACCCGCTCCATTGAC
TTTGGCTCGGTTGATCACATTGAAGACATGCCCACACCCAAAAAGGCTGCCAGCTCGGCGGCTCAGAGGGAAATG
GCTGTTGTGCCGACGCGGGAGCCGGACAATGAGCCAAGTGAGCAACAATCTCAGCTGACTGCTCTTGACTCTCCA
CCGCCACCCCTTGAGATTTACGCCACGGTCTCTGCAGAACTGCACATATTCCAGCCACAGCCAGGACACTTTACC
TTGGTGGACGACTCGGTTATTGCCACAATCTCGGAAGTGGGAAAATGGGAATACTGGCTGCAAGTTGACGGCAAA
GGTAAATCTTGGCTGGGAACGCCACTTGTTGCTGATATCAATCCCGTTTTCGATTTTGAATATCTCTCGTTTGTC
TTCAACTACTTTGGCAAGGATGGCACAGCTAGATCGTGGCTCCTGCGCTTCAAGGACCAGCCCACGTTGGAGACG
GCGCAGCGTGCCGTGTTGCAGGCCATTTGGGAGAGATTAAACGAGACCAAGTGGGCCAAGATTCAAGAAAAGGAG
CGCGAGTATGTGCTCGATAGCTTTGCCGATTTGGCCATGGAAGATGCTCCTGAGAATCAGGAAGAAGAAGAGGAG
GAAGAGGATGAATCGCCAGCCGACGACGAGGACGACAAGGGCGTGCACAGTGAAGGCTATGACTCGGACGATGAC
GAGCACGCCGAGCAAGAGAGGAATCAAGGCGAAGTCAACTCGCAACTGGCTGTTGGCTACAAGCACGACCGGTCC
TTTGTTGTGCGCGGCTCCAAGATTGGCGTCTTTTCGCACACTGACGACAATCGGCTCAAGTTTGCCACAAACATC
TCAAAGGTGACGACTCCGGGCGGAAAGCTCATGAGTCCCAAAAAAGTGATGCTGCATAGCGAGGACCGCGATCTC
ATTATGCAAAACAAGATTGACCCGAACAAGCTTTACCGCATGGATATTGAGTATGGCAAGGTGGTTGACGAGTGG
AACGTTCACGACGACGTGCCCGTGGTCAACTTTGCCCCCGAGAACAAGTTTGCGCAAATGACTGCGGAGCAAACA
TTTCTTGGAATTTCCAACAATGCGCTCTACCGCATTGACCCGCGTCTGTCTGGAAACAAGCTTGTCGACACCGAC
ATGAAGCAGTATGCCTCCAAGAATGACTTTTCTGCCCTGGCCACGACGGAAAAGGGCTACATTGCCGTGGCGAGC
AACAAGGGCGACATTCGCCTATTTGACCGCCTGGGCATCCGAGCCAAGACGCAGCTCCCCGCGCTCGGCGACCCC
ATTATCGGCATGGACGTGTCGGCCAACGGCCGCTGGATCCTGGGCACCACGAAGAATTACTTGCTCCTTATTGAC
GCGCAGCAACGAGGCGGCAAGAATGACGGCCGGCTAGGCTTTGAACGCGCCTTTTCTGCCGACACCAAGCCCCAT
CCCCGCCGCCTCGGCCTGACGCCCGAGCACGTGGCGCAGTTTCACTACGAAACTGGCAAACCCGTCTGCTTCACC
CCCGCCAAATTTAACACGGGCGCCGCCGGCACCGAGGAAACGAGCATCATTACCGCCACGGGGCCGTATATTATT
GAGTGGAATCTAAAGCGCCTCCTGCGTAGCCCCAAGGGCGCGTACAAGATTAAGCGCTACCAGGAAGACGTGCAG
GCCGACGACTTCAAGTTTGGCTCGGATAAAAATGTAATTGTGGCGCTGCCCAATGAGGTAAACATGGTGGCCAAG
CAGAGTCTGCGCCGTCCCACGCGTCAGAGCCTCTTGGGTGAGGGCCTGGATGGCGGTGGCGCGAGGCAGAGCTTG
GGGCGCATTGGGACGAGGGATAGTGGAAGGTATAAGCTGGGCAAGAATGATGTTGTGAATGCGCCGTATTGA
Transcript >OphauB2|6591
ATGTTTGTTCTACGCAACGTCGGCAAGCTGCTCTTCGGCTCTGCAGCCCAGGAATCCATCATCGATATCCCCCAA
GGACAGCTTTACTTGGTCCGCCCGCTATCGCCCAAGGGCTACTCAGAGCTCATTTTTAGAGACGCCACGATTCGC
ATCCGTCGCACAAACCAAGACTTTCATTATCAGCTCGTTGTACAGCGCGTCTTTGAAGAAGGCGAGGCTGAGCTA
CTCGCCGACGAAGAAGGCGACGATTTGGAGGTGGATGCTCTGGCGGCGGAGCGGGACGAAAAGACATTTCTACTC
GACGAGGCCTTGTGCTTGCGGGTCGACGCCAGGCACGACGGCGAAAAGGTTCTTGCTTGGAAGGATCTAAGTGGC
GATACGGGCGACGTTTACGAATTCGTTTGCGATAGTCTAGTCTCGGCTGTCCAGGTGCAACAATTTATTGAGACT
GCTCGCCACTGTCAGTACGAGCGCAAATACCGCAAGCCGCATACCACGGCTTCCGAAGTCGATCTCAAACACTTT
GACTTTGAAGACATTGATTACCCGATTCCGCCCGCGAGCCCCCTCCACAGCCCCTCACTTACCCGCTCCATTGAC
TTTGGCTCGGTTGATCACATTGAAGACATGCCCACACCCAAAAAGGCTGCCAGCTCGGCGGCTCAGAGGGAAATG
GCTGTTGTGCCGACGCGGGAGCCGGACAATGAGCCAAGTGAGCAACAATCTCAGCTGACTGCTCTTGACTCTCCA
CCGCCACCCCTTGAGATTTACGCCACGGTCTCTGCAGAACTGCACATATTCCAGCCACAGCCAGGACACTTTACC
TTGGTGGACGACTCGGTTATTGCCACAATCTCGGAAGTGGGAAAATGGGAATACTGGCTGCAAGTTGACGGCAAA
GGTAAATCTTGGCTGGGAACGCCACTTGTTGCTGATATCAATCCCGTTTTCGATTTTGAATATCTCTCGTTTGTC
TTCAACTACTTTGGCAAGGATGGCACAGCTAGATCGTGGCTCCTGCGCTTCAAGGACCAGCCCACGTTGGAGACG
GCGCAGCGTGCCGTGTTGCAGGCCATTTGGGAGAGATTAAACGAGACCAAGTGGGCCAAGATTCAAGAAAAGGAG
CGCGAGTATGTGCTCGATAGCTTTGCCGATTTGGCCATGGAAGATGCTCCTGAGAATCAGGAAGAAGAAGAGGAG
GAAGAGGATGAATCGCCAGCCGACGACGAGGACGACAAGGGCGTGCACAGTGAAGGCTATGACTCGGACGATGAC
GAGCACGCCGAGCAAGAGAGGAATCAAGGCGAAGTCAACTCGCAACTGGCTGTTGGCTACAAGCACGACCGGTCC
TTTGTTGTGCGCGGCTCCAAGATTGGCGTCTTTTCGCACACTGACGACAATCGGCTCAAGTTTGCCACAAACATC
TCAAAGGTGACGACTCCGGGCGGAAAGCTCATGAGTCCCAAAAAAGTGATGCTGCATAGCGAGGACCGCGATCTC
ATTATGCAAAACAAGATTGACCCGAACAAGCTTTACCGCATGGATATTGAGTATGGCAAGGTGGTTGACGAGTGG
AACGTTCACGACGACGTGCCCGTGGTCAACTTTGCCCCCGAGAACAAGTTTGCGCAAATGACTGCGGAGCAAACA
TTTCTTGGAATTTCCAACAATGCGCTCTACCGCATTGACCCGCGTCTGTCTGGAAACAAGCTTGTCGACACCGAC
ATGAAGCAGTATGCCTCCAAGAATGACTTTTCTGCCCTGGCCACGACGGAAAAGGGCTACATTGCCGTGGCGAGC
AACAAGGGCGACATTCGCCTATTTGACCGCCTGGGCATCCGAGCCAAGACGCAGCTCCCCGCGCTCGGCGACCCC
ATTATCGGCATGGACGTGTCGGCCAACGGCCGCTGGATCCTGGGCACCACGAAGAATTACTTGCTCCTTATTGAC
GCGCAGCAACGAGGCGGCAAGAATGACGGCCGGCTAGGCTTTGAACGCGCCTTTTCTGCCGACACCAAGCCCCAT
CCCCGCCGCCTCGGCCTGACGCCCGAGCACGTGGCGCAGTTTCACTACGAAACTGGCAAACCCGTCTGCTTCACC
CCCGCCAAATTTAACACGGGCGCCGCCGGCACCGAGGAAACGAGCATCATTACCGCCACGGGGCCGTATATTATT
GAGTGGAATCTAAAGCGCCTCCTGCGTAGCCCCAAGGGCGCGTACAAGATTAAGCGCTACCAGGAAGACGTGCAG
GCCGACGACTTCAAGTTTGGCTCGGATAAAAATGTAATTGTGGCGCTGCCCAATGAGGTAAACATGGTGGCCAAG
CAGAGTCTGCGCCGTCCCACGCGTCAGAGCCTCTTGGGTGAGGGCCTGGATGGCGGTGGCGCGAGGCAGAGCTTG
GGGCGCATTGGGACGAGGGATAGTGGAAGGTATAAGCTGGGCAAGAATGATGTTGTGAATGCGCCGTATTGA
Gene >OphauB2|6591
ATGTTTGTTCTACGCAACGGTGAGTCTAGCTGGCCTTTGCCTTTTTTTTTTGCAGCAGCCAATGACATTGGGGGA
GCCGGCGCCCCGCCACTTCTTTGCTCCTTCAAAGCAAATCGCTTCTTGCGACTTGTATAAGCTGTCGCTAGCCGT
CCTTGTACTTGCATCTTTGCTCTTTTTTTCCCCCTTGGGTTTACTGTATTTTGACTTGTACTGGCTCTCTTGATT
CAATGATTGAGCCCCGACTAATGACTGCCGCGTGTCCATAGTCGGCAAGCTGCTCTTCGGCTCTGCAGCCCAGGA
ATCCATCATCGATATCCCCCAAGGACAGCTTTACTTGGTCCGCCCGCTATCGCCCAAGGGCTACTCAGAGCTCAT
TTTTAGAGACGCCACGATTCGCATCCGTCGCACAAACCAAGACTTTCATTATCAGCTCGTTGTACAGCGCGTCTT
TGAAGAAGGCGAGGCTGAGCTACTCGCCGACGAAGAAGGCGACGATTTGGAGGTGGATGCTCTGGCGGCGGAGCG
GGACGAAAAGACATTTCTACTCGACGAGGCCTTGTGCTTGCGGGTCGACGCCAGGCACGACGGCGAAAAGGTTCT
TGCTTGGAAGGATCTAAGTGGCGATACGGGCGACGTTTACGAATTCGTTTGCGATAGTCTAGTCTCGGCTGTCCA
GGTGCAACAATTTATTGAGACTGCTCGCCACTGTCAGTACGAGCGCAAATACCGCAAGCCGCATACCACGGCTTC
CGAAGTCGATCTCAAACACTTTGACTTTGAAGACATTGATTACCCGATTCCGCCCGCGAGCCCCCTCCACAGCCC
CTCACTTACCCGCTCCATTGACTTTGGCTCGGTTGATCACATTGAAGACATGCCCACACCCAAAAAGGCTGCCAG
CTCGGCGGCTCAGAGGGAAATGGCTGTTGTGCCGACGCGGGAGCCGGACAATGAGCCAAGTGAGCAACAATCTCA
GCTGACTGCTCTTGACTCTCCACCGCCACCCCTTGAGATTTACGCCACGGTCTCTGCAGAACTGCACATATTCCA
GCCACAGCCAGGACACTTTACCTTGGTGGACGACTCGGTTATTGCCACAATCTCGGAAGTGGGAAAATGGGAATA
CTGGCTGCAAGTTGACGGCAAAGGTAAATCTTGGCTGGGAACGCCACTTGTTGCTGATATCAATCCCGTTTTCGA
TTTTGAATATCTCTCGTTTGTCTTCAACTACTTTGGCAAGGATGGCACAGCTAGATCGTGGCTCCTGCGCTTCAA
GGACCAGCCCACGTTGGAGACGGCGCAGCGTGCCGTGTTGCAGGCCATTTGGGAGAGATTAAACGAGACCAAGTG
GGCCAAGATTCAAGAAAAGGAGCGCGAGTATGTGCTCGATAGCTTTGCCGATTTGGCCATGGAAGATGCTCCTGA
GAATCAGGAAGAAGAAGAGGAGGAAGAGGATGAATCGCCAGCCGACGACGAGGACGACAAGGGCGTGCACAGTGA
AGGCTATGACTCGGACGATGACGAGCACGCCGAGCAAGAGAGGAATCAAGGCGAAGTCAACTCGCAACTGGCTGT
TGGCTACAAGCACGACCGGTCCTTTGTTGTGCGCGGCTCCAAGATTGGCGTCTTTTCGCACACTGACGACAATCG
GCTCAAGTTTGCCACAAACATCTCAAAGGTGACGACTCCGGGCGGAAAGCTCATGAGTCCCAAAAAAGTGATGCT
GCATAGCGAGGACCGCGATCTCATTATGCAAAACAAGATTGACCCGAACAAGCTTTACCGCATGGATATTGAGTA
TGGCAAGGTGGTTGACGAGTGGAACGTTCACGACGACGTGCCCGTGGTCAACTTTGCCCCCGAGAACAAGTTTGC
GCAAATGACTGCGGAGCAAACATTTCTTGGAATTTCCAACAATGCGCTCTACCGCATTGACCCGCGTCTGTCTGG
AAACAAGCTTGTCGACACCGACATGAAGCAGTATGCCTCCAAGAATGACTTTTCTGCCCTGGCCACGACGGAAAA
GGGCTACATTGCCGTGGCGAGCAACAAGGGCGACATTCGCCTATTTGACCGCCTGGGCATCCGAGCCAAGACGCA
GCTCCCCGCGCTCGGCGACCCCATTATCGGCATGGACGTGTCGGCCAACGGCCGCTGGATCCTGGGCACCACGAA
GAATTACTTGCTCCTTATTGACGCGCAGCAACGAGGCGGCAAGAATGACGGCCGGCTAGGCTTTGAACGCGCCTT
TTCTGCCGACACCAAGCCCCATCCCCGCCGCCTCGGCCTGACGCCCGAGCACGTGGCGCAGTTTCACTACGAAAC
TGGCAAACCCGTCTGCTTCACCCCCGCCAAATTTAACACGGGCGCCGCCGGCACCGAGGAAACGAGCATCATTAC
CGCCACGGGGCCGTATATTATTGAGTGGAATCTAAAGCGCCTCCTGCGTAGCCCCAAGGGCGCGTACAAGATTAA
GCGCTACCAGGAAGACGTGCAGGCCGACGACTTCAAGTTTGGCTCGGATAAAAATGTAATTGTGGCGCTGCCCAA
TGAGGTAAACATGGTGGCCAAGCAGAGTCTGCGCCGTCCCACGCGTCAGAGCCTCTTGGGTGAGGGCCTGGATGG
CGGTGGCGCGAGGCAGAGCTTGGGGCGCATTGGGACGAGGGATAGTGGAAGGTATAAGCTGGGCAAGAATGATGT
TGTGAATGCGCCGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail