Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6578
Gene name
LocationContig_60:89707..90833
Strand+
Gene length (bp)1126
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00800 PDT Prephenate dehydratase 1.4E-58 10 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O67085|PHEA_AQUAE P-protein OS=Aquifex aeolicus (strain VF5) GN=pheA PE=3 SV=1 2 327 5.0E-40
sp|Q9HZ67|PHEA_PSEAE P-protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pheA PE=3 SV=1 10 327 2.0E-37
sp|Q9ZHY3|PHEA_NEIG1 P-protein OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pheA PE=3 SV=2 10 327 5.0E-36
sp|P27603|PHEA_PSEST P-protein OS=Pseudomonas stutzeri GN=pheA PE=3 SV=2 10 327 7.0E-36
sp|O14361|PHA2_SCHPO Putative prephenate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pha2 PE=3 SV=2 10 297 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O67085|PHEA_AQUAE P-protein OS=Aquifex aeolicus (strain VF5) GN=pheA PE=3 SV=1 2 327 5.0E-40
sp|Q9HZ67|PHEA_PSEAE P-protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pheA PE=3 SV=1 10 327 2.0E-37
sp|Q9ZHY3|PHEA_NEIG1 P-protein OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pheA PE=3 SV=2 10 327 5.0E-36
sp|P27603|PHEA_PSEST P-protein OS=Pseudomonas stutzeri GN=pheA PE=3 SV=2 10 327 7.0E-36
sp|O14361|PHA2_SCHPO Putative prephenate dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pha2 PE=3 SV=2 10 297 1.0E-35
sp|Q58054|PHEA_METJA Prephenate dehydratase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pheA PE=1 SV=1 10 299 1.0E-29
sp|P32452|PHA2_YEAST Putative prephenate dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHA2 PE=1 SV=3 2 295 4.0E-27
sp|P21203|PHEA_BACSU Prephenate dehydratase OS=Bacillus subtilis (strain 168) GN=pheA PE=3 SV=1 10 328 3.0E-26
sp|P0A9K0|PHEA_SHIFL P-protein OS=Shigella flexneri GN=pheA PE=3 SV=1 10 327 6.0E-25
sp|P0A9J8|PHEA_ECOLI P-protein OS=Escherichia coli (strain K12) GN=pheA PE=1 SV=1 10 327 6.0E-25
sp|P0A9J9|PHEA_ECO57 P-protein OS=Escherichia coli O157:H7 GN=pheA PE=3 SV=1 10 327 6.0E-25
sp|Q9SA96|AROD1_ARATH Arogenate dehydratase/prephenate dehydratase 1, chloroplastic OS=Arabidopsis thaliana GN=ADT1 PE=1 SV=1 5 327 2.0E-23
sp|Q9SSE7|AROD2_ARATH Arogenate dehydratase/prephenate dehydratase 2, chloroplastic OS=Arabidopsis thaliana GN=ADT2 PE=1 SV=1 10 327 3.0E-23
sp|P43900|PHEA_HAEIN P-protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pheA PE=3 SV=1 10 327 7.0E-23
sp|Q02286|PHEA_ENTAG P-protein OS=Enterobacter agglomerans GN=pheA PE=3 SV=1 10 327 8.0E-23
sp|Q9CEU2|PHEA_LACLA Prephenate dehydratase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pheA PE=3 SV=1 10 327 1.0E-21
sp|Q8K9F8|PHEA_BUCAP P-protein OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pheA PE=3 SV=1 11 327 2.0E-20
sp|Q9CDC4|PHEA_MYCLE Prephenate dehydratase OS=Mycobacterium leprae (strain TN) GN=pheA PE=3 SV=1 10 327 4.0E-20
sp|B8ZTU2|PHEA_MYCLB Prephenate dehydratase OS=Mycobacterium leprae (strain Br4923) GN=pheA PE=3 SV=1 10 327 4.0E-20
sp|A4T6G3|PHEA_MYCGI Prephenate dehydratase OS=Mycobacterium gilvum (strain PYR-GCK) GN=pheA PE=3 SV=1 8 327 1.0E-19
sp|A0R643|PHEA_MYCS2 Prephenate dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pheA PE=3 SV=1 8 327 2.0E-19
sp|P43909|PHEA_LACLM Prephenate dehydratase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pheA PE=3 SV=1 10 327 5.0E-18
sp|P9WIC3|PHEA_MYCTU Prephenate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pheA PE=1 SV=1 10 327 6.0E-18
sp|Q7TVJ6|PHEA_MYCBO Prephenate dehydratase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pheA PE=1 SV=1 10 327 6.0E-18
sp|A1KQH3|PHEA_MYCBP Prephenate dehydratase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pheA PE=3 SV=1 10 327 6.0E-18
sp|P9WIC2|PHEA_MYCTO Prephenate dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pheA PE=3 SV=1 10 327 6.0E-18
sp|A5U9G7|PHEA_MYCTA Prephenate dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pheA PE=3 SV=1 10 327 6.0E-18
sp|P57472|PHEA_BUCAI P-protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pheA PE=3 SV=1 11 327 9.0E-18
sp|Q89AE5|PHEA_BUCBP P-protein OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=pheA PE=3 SV=1 10 297 1.0E-17
sp|A1TGX7|PHEA_MYCVP Prephenate dehydratase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=pheA PE=3 SV=1 8 327 4.0E-17
sp|Q44104|PHEA_AMYME Prephenate dehydratase OS=Amycolatopsis methanolica GN=pheA PE=3 SV=1 10 330 5.0E-17
sp|B2HMM5|PHEA_MYCMM Prephenate dehydratase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pheA PE=3 SV=1 10 327 9.0E-16
sp|A0PX17|PHEA_MYCUA Prephenate dehydratase OS=Mycobacterium ulcerans (strain Agy99) GN=pheA PE=3 SV=1 10 327 1.0E-15
sp|Q9SGD6|AROD6_ARATH Arogenate dehydratase/prephenate dehydratase 6, chloroplastic OS=Arabidopsis thaliana GN=ADT6 PE=1 SV=1 10 327 2.0E-15
sp|O22241|AROD4_ARATH Arogenate dehydratase 4, chloroplastic OS=Arabidopsis thaliana GN=ADT4 PE=1 SV=1 10 327 4.0E-15
sp|Q9ZUY3|AROD3_ARATH Arogenate dehydratase 3, chloroplastic OS=Arabidopsis thaliana GN=ADT3 PE=1 SV=1 10 327 6.0E-15
sp|Q745J2|PHEA_MYCPA Prephenate dehydratase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=pheA PE=3 SV=1 10 327 1.0E-14
sp|A0Q994|PHEA_MYCA1 Prephenate dehydratase OS=Mycobacterium avium (strain 104) GN=pheA PE=3 SV=1 10 327 1.0E-14
sp|A3Q7Q1|PHEA_MYCSJ Prephenate dehydratase OS=Mycobacterium sp. (strain JLS) GN=pheA PE=3 SV=1 8 327 1.0E-14
sp|Q1B1U6|PHEA_MYCSS Prephenate dehydratase OS=Mycobacterium sp. (strain MCS) GN=pheA PE=3 SV=1 8 327 1.0E-14
sp|A1UNA3|PHEA_MYCSK Prephenate dehydratase OS=Mycobacterium sp. (strain KMS) GN=pheA PE=3 SV=1 8 327 1.0E-14
sp|Q9FNJ8|AROD5_ARATH Arogenate dehydratase 5, chloroplastic OS=Arabidopsis thaliana GN=ADT5 PE=1 SV=1 10 327 4.0E-14
sp|B1MEG8|PHEA_MYCA9 Prephenate dehydratase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=pheA PE=3 SV=1 10 329 6.0E-13
sp|P10341|PHEA_CORGL Prephenate dehydratase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pheA PE=3 SV=2 4 331 8.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004664 prephenate dehydratase activity Yes
GO:0009094 L-phenylalanine biosynthetic process Yes
GO:1901607 alpha-amino acid biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009073 aromatic amino acid family biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0016829 lyase activity No
GO:1901605 alpha-amino acid metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:1902223 erythrose 4-phosphate/phosphoenolpyruvate family amino acid biosynthetic process No
GO:0006558 L-phenylalanine metabolic process No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1902221 erythrose 4-phosphate/phosphoenolpyruvate family amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0009095 aromatic amino acid family biosynthetic process, prephenate pathway No
GO:0016836 hydro-lyase activity No
GO:0009072 aromatic amino acid family metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0019438 aromatic compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6578
MMASDAKPVVSFLGPVASFSHQAVRQTFSEDGWVLRPVTTIDDVFDQVQQRQALLGVVPFENSTNGSVVFTLDNL
ADRNGRYKDISVNGEIYVEVEHCLLGHKTPAPAPAASTGNSGADTPTPTDPVPQGPKTQPLSSLRHIKRLYSHPQ
AFGQCHAFISAHLKEAETFDTSSTSQAAEIVSRDQTGTWAAISNIMAASVQGLDVLHRAIQDRQDNTTRFLVIGS
SPSLPKDDRLLAQPQIAGSKSLISFTVPHSSPGALAVVLGCFHDFNLNLTSINSRPSLLEPFQYIFFVEFEGHRL
EDADGRVKGALRKIDLVAESSRWLGSWRRCR*
Coding >OphauB2|6578
ATGATGGCTTCTGACGCCAAGCCCGTCGTCAGCTTTCTGGGCCCTGTTGCCTCATTTTCACACCAGGCTGTCCGT
CAGACCTTTTCAGAAGACGGCTGGGTCTTGCGGCCCGTCACCACCATAGATGATGTCTTTGATCAGGTCCAACAG
CGGCAAGCCCTGCTGGGCGTCGTGCCGTTTGAAAACTCAACCAACGGCTCTGTAGTCTTTACCCTGGACAACTTG
GCCGACCGGAATGGCCGGTATAAAGACATTAGCGTCAATGGCGAGATCTATGTCGAGGTCGAGCACTGCCTGCTC
GGACACAAAACACCAGCTCCGGCTCCGGCCGCCTCCACTGGCAACTCCGGAGCTGATACTCCGACCCCTACCGAT
CCGGTACCCCAGGGGCCAAAGACGCAGCCGCTCAGCAGCTTGCGACACATCAAGAGGCTGTATTCGCACCCGCAA
GCCTTTGGCCAGTGCCACGCATTCATCTCTGCCCACCTCAAGGAAGCTGAGACATTCGACACCAGCTCTACCAGC
CAAGCCGCCGAGATTGTCAGCCGGGACCAGACGGGAACATGGGCTGCCATTTCCAACATCATGGCCGCTAGCGTC
CAGGGCCTTGATGTCCTCCACAGGGCCATTCAGGACCGCCAGGACAATACTACTCGCTTTCTCGTCATTGGGTCC
AGTCCGTCTCTGCCCAAGGATGACAGGCTTCTCGCGCAGCCCCAGATTGCTGGTAGCAAGTCGCTCATTTCCTTT
ACCGTGCCTCACTCGAGTCCTGGAGCGCTGGCTGTAGTGCTGGGCTGCTTCCACGATTTCAATCTCAATCTGACG
AGCATAAACAGCCGGCCTAGTCTGTTGGAACCTTTTCAGTATATATTCTTTGTGGAGTTTGAGGGCCATCGGCTA
GAAGATGCCGACGGAAGGGTTAAAGGGGCACTGCGCAAAATTGATCTTGTTGCCGAGAGCTCAAGGTGGCTTGGC
AGCTGGAGACGATGTAGATGA
Transcript >OphauB2|6578
ATGATGGCTTCTGACGCCAAGCCCGTCGTCAGCTTTCTGGGCCCTGTTGCCTCATTTTCACACCAGGCTGTCCGT
CAGACCTTTTCAGAAGACGGCTGGGTCTTGCGGCCCGTCACCACCATAGATGATGTCTTTGATCAGGTCCAACAG
CGGCAAGCCCTGCTGGGCGTCGTGCCGTTTGAAAACTCAACCAACGGCTCTGTAGTCTTTACCCTGGACAACTTG
GCCGACCGGAATGGCCGGTATAAAGACATTAGCGTCAATGGCGAGATCTATGTCGAGGTCGAGCACTGCCTGCTC
GGACACAAAACACCAGCTCCGGCTCCGGCCGCCTCCACTGGCAACTCCGGAGCTGATACTCCGACCCCTACCGAT
CCGGTACCCCAGGGGCCAAAGACGCAGCCGCTCAGCAGCTTGCGACACATCAAGAGGCTGTATTCGCACCCGCAA
GCCTTTGGCCAGTGCCACGCATTCATCTCTGCCCACCTCAAGGAAGCTGAGACATTCGACACCAGCTCTACCAGC
CAAGCCGCCGAGATTGTCAGCCGGGACCAGACGGGAACATGGGCTGCCATTTCCAACATCATGGCCGCTAGCGTC
CAGGGCCTTGATGTCCTCCACAGGGCCATTCAGGACCGCCAGGACAATACTACTCGCTTTCTCGTCATTGGGTCC
AGTCCGTCTCTGCCCAAGGATGACAGGCTTCTCGCGCAGCCCCAGATTGCTGGTAGCAAGTCGCTCATTTCCTTT
ACCGTGCCTCACTCGAGTCCTGGAGCGCTGGCTGTAGTGCTGGGCTGCTTCCACGATTTCAATCTCAATCTGACG
AGCATAAACAGCCGGCCTAGTCTGTTGGAACCTTTTCAGTATATATTCTTTGTGGAGTTTGAGGGCCATCGGCTA
GAAGATGCCGACGGAAGGGTTAAAGGGGCACTGCGCAAAATTGATCTTGTTGCCGAGAGCTCAAGGTGGCTTGGC
AGCTGGAGACGATGTAGATGA
Gene >OphauB2|6578
ATGATGGCTTCTGACGCCAAGCCCGTCGTCAGCTTTCTGGGCCCTGTTGCCTCATTTTCACACCAGGTCGTTGCC
GTTTGACCCGCCCCCGCTCGTCTCTCGACGCTATGGCTAACCTTGCAAGCATTCCAGGCTGTCCGTCAGACCTTT
TCAGAAGACGGCTGGGTCTTGCGGCCCGTCACCACCATAGATGGTAGATGCTTTCAGAAGTCTGTCTGGTTTGCC
AGCCCGGCCTCTTACTAACTCCTTGTCCCTAGATGTCTTTGATCAGGTCCAACAGCGGCAAGCCCTGCTGGGCGT
CGTGCCGTTTGAAAACTCAACCAACGGCTCTGTAGTCTTTACCCTGGACAACTTGGCCGACCGGAATGGCCGGTA
TAAAGACATTAGCGTCAATGGCGAGATCTATGTCGAGGTCGAGCACTGCCTGCTCGGACACAAAACACCAGCTCC
GGCTCCGGCCGCCTCCACTGGCAACTCCGGAGCTGATACTCCGACCCCTACCGATCCGGTACCCCAGGGGCCAAA
GACGCAGCCGCTCAGCAGCTTGCGACACATCAAGAGGCTGTATTCGCACCCGCAAGCCTTTGGCCAGTGCCACGC
ATTCATCTCTGCCCACCTCAAGGAAGCTGAGACATTCGACACCAGCTCTACCAGCCAAGCCGCCGAGATTGTCAG
CCGGGACCAGACGGGAACATGGGCTGCCATTTCCAACATCATGGCCGCTAGCGTCCAGGGCCTTGATGTCCTCCA
CAGGGCCATTCAGGACCGCCAGGACAATACTACTCGCTTTCTCGTCATTGGGTCCAGTCCGTCTCTGCCCAAGGA
TGACAGGCTTCTCGCGCAGCCCCAGATTGCTGGTAGCAAGTCGCTCATTTCCTTTACCGTGCCTCACTCGAGTCC
TGGAGCGCTGGCTGTAGTGCTGGGCTGCTTCCACGATTTCAATCTCAATCTGACGAGCATAAACAGCCGGCCTAG
TCTGTTGGAACCTTTTCAGTATATATTCTTTGTGGAGTTTGAGGGCCATCGGCTAGAAGATGCCGACGGAAGGGT
TAAAGGGGCACTGCGCAAAATTGATCTTGTTGCCGAGAGCTCAAGGTGGCTTGGCAGCTGGAGACGATGTAGATG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail