Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6570
Gene name
LocationContig_60:70275..70949
Strand-
Gene length (bp)674
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.2E-16 51 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 45 167 1.0E-60
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 28 166 7.0E-60
sp|Q5ZKR5|NCBP2_CHICK Nuclear cap-binding protein subunit 2 OS=Gallus gallus GN=NCBP2 PE=2 SV=1 26 166 2.0E-59
sp|Q9P383|NCBP2_SCHPO Nuclear cap-binding protein subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc2 PE=3 SV=1 7 160 2.0E-59
sp|Q54KR9|NCBP2_DICDI Nuclear cap-binding protein subunit 2 OS=Dictyostelium discoideum GN=ncbp2 PE=3 SV=1 36 160 8.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 45 167 1.0E-60
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 28 166 7.0E-60
sp|Q5ZKR5|NCBP2_CHICK Nuclear cap-binding protein subunit 2 OS=Gallus gallus GN=NCBP2 PE=2 SV=1 26 166 2.0E-59
sp|Q9P383|NCBP2_SCHPO Nuclear cap-binding protein subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc2 PE=3 SV=1 7 160 2.0E-59
sp|Q54KR9|NCBP2_DICDI Nuclear cap-binding protein subunit 2 OS=Dictyostelium discoideum GN=ncbp2 PE=3 SV=1 36 160 8.0E-59
sp|P52299|NCBP2_XENLA Nuclear cap-binding protein subunit 2 OS=Xenopus laevis GN=ncbp2 PE=2 SV=2 45 164 2.0E-58
sp|B1WC40|NCBP2_RAT Nuclear cap-binding protein subunit 2 OS=Rattus norvegicus GN=Ncbp2 PE=1 SV=1 45 160 3.0E-58
sp|Q9CQ49|NCBP2_MOUSE Nuclear cap-binding protein subunit 2 OS=Mus musculus GN=Ncbp2 PE=1 SV=1 45 160 3.0E-58
sp|C0H859|NCBP2_SALSA Nuclear cap-binding protein subunit 2 OS=Salmo salar GN=ncbp2 PE=2 SV=1 45 163 4.0E-58
sp|Q177H0|NCBP2_AEDAE Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 45 167 5.0E-58
sp|Q6DES0|NCBP2_XENTR Nuclear cap-binding protein subunit 2 OS=Xenopus tropicalis GN=ncbp2 PE=2 SV=1 45 164 5.0E-58
sp|P52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 OS=Homo sapiens GN=NCBP2 PE=1 SV=1 45 160 8.0E-58
sp|Q3ZBJ1|NCBP2_BOVIN Nuclear cap-binding protein subunit 2 OS=Bos taurus GN=NCBP2 PE=2 SV=1 45 160 8.0E-58
sp|B0W939|NCBP2_CULQU Nuclear cap-binding protein subunit 2 OS=Culex quinquefasciatus GN=Cbp20 PE=3 SV=1 45 167 8.0E-58
sp|Q8JGR6|NCBP2_DANRE Nuclear cap-binding protein subunit 2 OS=Danio rerio GN=ncbp2 PE=2 SV=2 45 162 9.0E-58
sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 45 167 9.0E-58
sp|C1BY64|NCBP2_ESOLU Nuclear cap-binding protein subunit 2 OS=Esox lucius GN=ncbp2 PE=2 SV=1 45 162 3.0E-57
sp|B4LZ88|NCB2B_DROVI Nuclear cap-binding protein subunit 2B OS=Drosophila virilis GN=Cbp20-B PE=3 SV=1 44 163 2.0E-56
sp|B3LYP1|NCBP2_DROAN Nuclear cap-binding protein subunit 2 OS=Drosophila ananassae GN=Cbp20 PE=3 SV=1 44 163 2.0E-56
sp|B4JUT1|NCBP2_DROGR Nuclear cap-binding protein subunit 2 OS=Drosophila grimshawi GN=Cbp20 PE=3 SV=1 44 163 3.0E-56
sp|B4KCD5|NCBP2_DROMO Nuclear cap-binding protein subunit 2 OS=Drosophila mojavensis GN=Cbp20 PE=3 SV=1 44 163 5.0E-56
sp|B4NB54|NCBP2_DROWI Nuclear cap-binding protein subunit 2 OS=Drosophila willistoni GN=Cbp20 PE=3 SV=1 44 163 9.0E-56
sp|Q293V6|NCBP2_DROPS Nuclear cap-binding protein subunit 2 OS=Drosophila pseudoobscura pseudoobscura GN=Cbp20 PE=3 SV=1 44 163 3.0E-55
sp|B4GLK8|NCBP2_DROPE Nuclear cap-binding protein subunit 2 OS=Drosophila persimilis GN=Cbp20 PE=3 SV=1 44 163 3.0E-55
sp|A2SW84|NCBP2_SINCH Nuclear cap-binding protein subunit 2 OS=Siniperca chuatsi GN=ncbp2 PE=2 SV=1 45 166 4.0E-55
sp|B4QV17|NCBP2_DROSI Nuclear cap-binding protein subunit 2 OS=Drosophila simulans GN=Cbp20 PE=3 SV=1 44 163 7.0E-55
sp|B4IBA4|NCBP2_DROSE Nuclear cap-binding protein subunit 2 OS=Drosophila sechellia GN=Cbp20 PE=3 SV=1 44 163 7.0E-55
sp|Q9V3L6|NCBP2_DROME Nuclear cap-binding protein subunit 2 OS=Drosophila melanogaster GN=Cbp20 PE=1 SV=1 44 163 7.0E-55
sp|B4PL68|NCBP2_DROYA Nuclear cap-binding protein subunit 2 OS=Drosophila yakuba GN=Cbp20 PE=3 SV=1 44 163 9.0E-55
sp|B3P0D7|NCBP2_DROER Nuclear cap-binding protein subunit 2 OS=Drosophila erecta GN=Cbp20 PE=3 SV=1 44 163 1.0E-54
sp|Q84L14|NCBP2_ORYSJ Nuclear cap-binding protein subunit 2 OS=Oryza sativa subsp. japonica GN=CBP20 PE=2 SV=1 45 165 8.0E-54
sp|B4M205|NCB2A_DROVI Nuclear cap-binding protein subunit 2-A OS=Drosophila virilis GN=Cbp20-A PE=3 SV=1 44 163 1.0E-53
sp|Q1HE01|NCBP2_BOMMO Nuclear cap-binding protein subunit 2 OS=Bombyx mori PE=2 SV=1 45 148 1.0E-52
sp|Q9XFD1|NCBP2_ARATH Nuclear cap-binding protein subunit 2 OS=Arabidopsis thaliana GN=CBP20 PE=1 SV=1 43 165 4.0E-52
sp|A8Y1R8|NCBP2_CAEBR Nuclear cap-binding protein subunit 2 OS=Caenorhabditis briggsae GN=ncbp-2 PE=3 SV=2 12 167 4.0E-52
sp|Q93594|NCBP2_CAEEL Nuclear cap-binding protein subunit 2 OS=Caenorhabditis elegans GN=ncbp-2 PE=3 SV=2 8 162 4.0E-52
sp|Q754W7|NCBP2_ASHGO Nuclear cap-binding protein subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CBC2 PE=3 SV=1 8 157 6.0E-52
sp|Q08920|NCBP2_YEAST Nuclear cap-binding protein subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBC2 PE=1 SV=1 8 167 1.0E-51
sp|A6PVI3|NCB2L_HUMAN Nuclear cap-binding protein subunit 2-like OS=Homo sapiens GN=NCBP2L PE=3 SV=1 45 160 6.0E-44
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 51 123 1.0E-10
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 45 123 5.0E-10
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 51 123 1.0E-09
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 51 123 1.0E-09
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 51 123 2.0E-09
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 51 123 2.0E-09
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 51 123 2.0E-09
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 51 123 1.0E-08
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 39 123 4.0E-08
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 51 123 5.0E-08
sp|Q9V535|RBM8A_DROME RNA-binding protein 8A OS=Drosophila melanogaster GN=tsu PE=1 SV=1 24 124 6.0E-08
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 44 124 6.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 51 123 6.0E-08
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 45 123 8.0E-08
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 39 123 1.0E-07
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 36 127 1.0E-07
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 39 123 1.0E-07
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 39 123 1.0E-07
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 33 169 1.0E-07
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 33 169 1.0E-07
sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 49 124 2.0E-07
sp|Q6PG31|RNPS1_DANRE RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1 44 116 2.0E-07
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 39 123 2.0E-07
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 39 123 2.0E-07
sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 49 124 3.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 51 123 4.0E-07
sp|Q28BZ1|RBM8A_XENTR RNA-binding protein 8A OS=Xenopus tropicalis GN=rbm8a PE=2 SV=1 25 136 4.0E-07
sp|O14327|PAB2_SCHPO Polyadenylate-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab2 PE=1 SV=1 33 122 4.0E-07
sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 49 124 5.0E-07
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 51 133 5.0E-07
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 51 133 5.0E-07
sp|Q9CZ96|ZCRB1_MOUSE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Mus musculus GN=Zcrb1 PE=1 SV=1 49 124 5.0E-07
sp|Q499V6|ZCRB1_RAT Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Rattus norvegicus GN=Zcrb1 PE=2 SV=1 49 124 5.0E-07
sp|Q94EH8|THO4C_ARATH THO complex subunit 4C OS=Arabidopsis thaliana GN=ALY3 PE=1 SV=1 14 130 6.0E-07
sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 49 124 6.0E-07
sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 49 124 6.0E-07
sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 49 124 6.0E-07
sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 49 124 6.0E-07
sp|Q6PH90|RB8AB_XENLA RNA-binding protein 8A-B OS=Xenopus laevis GN=rbm8a-b PE=2 SV=1 25 136 7.0E-07
sp|Q5D018|RBM8A_DANRE RNA-binding protein 8A OS=Danio rerio GN=rbm8a PE=2 SV=1 24 124 9.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 51 123 1.0E-06
sp|Q28E41|RNPS1_XENTR RNA-binding protein with serine-rich domain 1 OS=Xenopus tropicalis GN=rnps1 PE=2 SV=1 35 116 1.0E-06
sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 38 125 2.0E-06
sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 38 125 2.0E-06
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 50 111 3.0E-06
sp|Q5XG24|RNP1A_XENLA RNA-binding protein with serine-rich domain 1-A OS=Xenopus laevis GN=rnps1-a PE=2 SV=1 44 116 3.0E-06
sp|Q3KPW1|RNP1B_XENLA RNA-binding protein with serine-rich domain 1-B OS=Xenopus laevis GN=rnps1-b PE=2 SV=1 44 116 3.0E-06
sp|B5DGI7|RBM8A_SALSA RNA-binding protein 8A OS=Salmo salar GN=rbm8a PE=2 SV=1 25 124 3.0E-06
sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 36 125 3.0E-06
sp|Q9DF42|RB8AA_XENLA RNA-binding protein 8A-A OS=Xenopus laevis GN=rbm8a-a PE=2 SV=1 39 136 4.0E-06
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 51 154 4.0E-06
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 51 154 4.0E-06
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 51 154 4.0E-06
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 51 154 4.0E-06
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 48 137 4.0E-06
sp|Q66II8|RU17_XENTR U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus tropicalis GN=snrnp70 PE=2 SV=1 50 127 5.0E-06
sp|Q27W01|RBM8A_RAT RNA-binding protein 8A OS=Rattus norvegicus GN=Rbm8a PE=1 SV=1 25 124 7.0E-06
sp|Q9CWZ3|RBM8A_MOUSE RNA-binding protein 8A OS=Mus musculus GN=Rbm8a PE=1 SV=3 25 124 7.0E-06
sp|Q9Y5S9|RBM8A_HUMAN RNA-binding protein 8A OS=Homo sapiens GN=RBM8A PE=1 SV=1 25 124 7.0E-06
sp|Q3ZCE8|RBM8A_BOVIN RNA-binding protein 8A OS=Bos taurus GN=RBM8A PE=2 SV=2 25 124 7.0E-06
sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 50 124 7.0E-06
sp|Q99181|HSH49_YEAST Protein HSH49 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSH49 PE=1 SV=1 49 122 8.0E-06
sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 45 125 9.0E-06
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 51 129 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6570
MPPVIRSTVDRLDRPSAYFNNRNKRRRRDDDDAADEQLEPAVDPLANATTLYVGNLSFYTTEEQVYELFSKCGEI
KRLVMGLDRFQKTPCGFCFVEYYTHQDALDCMKYIGGTKLDERVIRTDLDPGFEEGRQYGRGKSGGQVRDEYRED
YDEGRGGVGRAINAERLRDYDEQGRYAGR*
Coding >OphauB2|6570
ATGCCGCCTGTCATTAGAAGCACCGTCGACCGCCTCGATAGACCAAGCGCCTACTTCAATAACAGAAACAAACGA
AGACGTCGTGACGACGACGACGCAGCTGATGAACAACTTGAACCCGCCGTCGACCCTCTTGCCAATGCCACAACT
CTCTATGTCGGCAATCTCTCTTTCTACACGACTGAAGAGCAAGTATACGAACTCTTCTCCAAATGCGGTGAGATA
AAGCGTCTGGTAATGGGCCTTGACCGGTTCCAAAAGACTCCCTGTGGCTTCTGCTTTGTCGAATACTACACCCAC
CAAGATGCGCTGGATTGCATGAAGTATATTGGCGGCACCAAGCTCGACGAGCGCGTCATTCGCACCGACCTCGAC
CCGGGTTTTGAGGAGGGAAGACAGTACGGACGCGGCAAGTCAGGCGGCCAGGTTCGAGACGAGTATCGCGAGGAT
TACGACGAAGGACGCGGTGGCGTTGGTAGGGCTATCAATGCGGAGCGTCTCCGGGACTACGACGAGCAAGGACGC
TACGCGGGACGGTGA
Transcript >OphauB2|6570
ATGCCGCCTGTCATTAGAAGCACCGTCGACCGCCTCGATAGACCAAGCGCCTACTTCAATAACAGAAACAAACGA
AGACGTCGTGACGACGACGACGCAGCTGATGAACAACTTGAACCCGCCGTCGACCCTCTTGCCAATGCCACAACT
CTCTATGTCGGCAATCTCTCTTTCTACACGACTGAAGAGCAAGTATACGAACTCTTCTCCAAATGCGGTGAGATA
AAGCGTCTGGTAATGGGCCTTGACCGGTTCCAAAAGACTCCCTGTGGCTTCTGCTTTGTCGAATACTACACCCAC
CAAGATGCGCTGGATTGCATGAAGTATATTGGCGGCACCAAGCTCGACGAGCGCGTCATTCGCACCGACCTCGAC
CCGGGTTTTGAGGAGGGAAGACAGTACGGACGCGGCAAGTCAGGCGGCCAGGTTCGAGACGAGTATCGCGAGGAT
TACGACGAAGGACGCGGTGGCGTTGGTAGGGCTATCAATGCGGAGCGTCTCCGGGACTACGACGAGCAAGGACGC
TACGCGGGACGGTGA
Gene >OphauB2|6570
ATGCCGCCTGTCATTAGAAGCACCGTCGACCGCCTCGATAGACCAAGCGCCTACTTCAATAACAGAGTGCACCTC
TACAAAAGCCCACACCTGCTCCAAGTATCAAGCGCTCATCATTTTTCTTGACAGAACAAACGAAGACGTCGTGAC
GACGACGACGCAGCTGATGAACAACTTGAACCCGCCGTCGACCCTCTTGCCAATGCCACAACTCTCTATGTCGGC
AATCTGTATGCCTCTGCAACCGACTTTGCATGCTCCTCTAGACCTCCTCTAAACTTTGCTGACCCTCTCTTCCTA
GCTCTTTCTACACGACTGAAGAGCAAGTATACGAACTCTTCTCCAAATGCGGTGAGATAAAGCGTCTGGTAATGG
GCCTTGACCGGTTCCAAAAGACTCCCTGTGGCTTCTGCTTTGTCGAATACTACACCCACCAAGATGCGCTGGATT
GCATGAAGTATATTGGCGGCACCAAGCTCGACGAGCGCGTCATTCGCACCGACCTCGACCCGGGTTTTGAGGAGG
GAAGACAGTACGGACGCGGCAAGTCAGGCGGCCAGGTTCGAGACGAGTATCGCGAGGATTACGACGAAGGACGCG
GTGGCGTTGGTAGGGCTATCAATGCGGAGCGTCTCCGGGACTACGACGAGCAAGGACGCTACGCGGGACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail