Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6567
Gene name
LocationContig_60:67600..68145
Strand+
Gene length (bp)545
Transcript length (bp)312
Coding sequence length (bp)312
Protein length (aa) 104

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold 3.5E-08 32 96
PF02969 TAF TATA box binding protein associated factor (TAF) 8.0E-05 31 92

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04914|H4_NEUCR Histone H4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH4-1 PE=3 SV=2 1 103 1.0E-65
sp|Q7LKT3|H4_ASPFU Histone H4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hhfA PE=3 SV=3 1 103 1.0E-65
sp|Q711M0|H41_TALFU Histone H4.1 OS=Talaromyces funiculosus GN=H4.1 PE=3 SV=3 1 103 1.0E-65
sp|Q76MU7|H4_ASPOR Histone H4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hhfA PE=3 SV=3 1 103 3.0E-65
sp|P23750|H41_EMENI Histone H4.1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfA PE=3 SV=2 1 103 3.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04914|H4_NEUCR Histone H4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH4-1 PE=3 SV=2 1 103 1.0E-65
sp|Q7LKT3|H4_ASPFU Histone H4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hhfA PE=3 SV=3 1 103 1.0E-65
sp|Q711M0|H41_TALFU Histone H4.1 OS=Talaromyces funiculosus GN=H4.1 PE=3 SV=3 1 103 1.0E-65
sp|Q76MU7|H4_ASPOR Histone H4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hhfA PE=3 SV=3 1 103 3.0E-65
sp|P23750|H41_EMENI Histone H4.1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfA PE=3 SV=2 1 103 3.0E-65
sp|Q8NIQ8|H42_TALFU Histone H4.2 OS=Talaromyces funiculosus GN=H4.2 PE=3 SV=3 1 103 1.0E-64
sp|Q9U7D0|H4_MASBA Histone H4 OS=Mastigamoeba balamuthi PE=3 SV=3 1 103 2.0E-54
sp|P23751|H42_EMENI Histone H4.2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhfB PE=3 SV=2 18 103 2.0E-53
sp|Q8J1L3|H4_BLAAD Histone H4 OS=Blastobotrys adeninivorans GN=ahsb4 PE=3 SV=3 18 103 7.0E-53
sp|P62791|H4_STYLE Histone H4 OS=Stylonychia lemnae PE=3 SV=2 1 103 1.0E-51
sp|P62790|H4_STENO Histone H4 OS=Sterkiella nova PE=3 SV=2 1 103 1.0E-51
sp|Q9HDF5|H4_MORAP Histone H4 OS=Mortierella alpina GN=H4.1 PE=3 SV=3 18 103 4.0E-51
sp|P09322|H4_SCHPO Histone H4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhf1 PE=1 SV=2 18 103 6.0E-51
sp|Q27765|H4_STYPL Histone H4 OS=Styela plicata PE=3 SV=3 18 103 8.0E-51
sp|Q8I0Y4|H4_OIKDI Histone H4 OS=Oikopleura dioica GN=H4.1 PE=3 SV=3 18 103 8.0E-51
sp|Q6LAF1|H4_DENKL Histone H4 OS=Dendronephthya klunzingeri GN=H4DEKL PE=3 SV=3 18 103 9.0E-51
sp|P35059|H4_ACRFO Histone H4 OS=Acropora formosa PE=3 SV=2 18 103 9.0E-51
sp|Q8NIG3|H4_CANGA Histone H4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HHF1 PE=3 SV=3 18 103 1.0E-50
sp|P04915|H4_PHYPO Histone H4 OS=Physarum polycephalum GN=H41 PE=3 SV=2 18 103 2.0E-50
sp|Q28DR4|H4_XENTR Histone H4 OS=Xenopus tropicalis GN=TGas006m08.1 PE=3 SV=1 18 103 2.0E-50
sp|P62799|H4_XENLA Histone H4 OS=Xenopus laevis PE=1 SV=2 18 103 2.0E-50
sp|P62798|H4_XENBO Histone H4 OS=Xenopus borealis PE=3 SV=2 18 103 2.0E-50
sp|P62794|H4_URECA Histone H4 OS=Urechis caupo PE=3 SV=2 18 103 2.0E-50
sp|P62804|H4_RAT Histone H4 OS=Rattus norvegicus GN=Hist1h4b PE=1 SV=2 18 103 2.0E-50
sp|Q5RCS7|H4_PONAB Histone H4 OS=Pongo abelii PE=3 SV=1 18 103 2.0E-50
sp|P62795|H4_PLADU Histone H4 OS=Platynereis dumerilii PE=3 SV=2 18 103 2.0E-50
sp|P62802|H4_PIG Histone H4 OS=Sus scrofa PE=1 SV=2 18 103 2.0E-50
sp|P62796|H4_ORENI Histone H4 OS=Oreochromis niloticus PE=3 SV=2 18 103 2.0E-50
sp|P62797|H4_ONCMY Histone H4 OS=Oncorhynchus mykiss PE=1 SV=2 18 103 2.0E-50
sp|Q6WV72|H4_MYTTR Histone H4 OS=Mytilus trossulus PE=3 SV=3 18 103 2.0E-50
sp|Q6WV90|H4_MYTGA Histone H4 OS=Mytilus galloprovincialis PE=3 SV=3 18 103 2.0E-50
sp|Q7K8C0|H4_MYTED Histone H4 OS=Mytilus edulis PE=3 SV=3 18 103 2.0E-50
sp|Q6WV73|H4_MYTCA Histone H4 OS=Mytilus californianus PE=3 SV=3 18 103 2.0E-50
sp|P62806|H4_MOUSE Histone H4 OS=Mus musculus GN=Hist1h4a PE=1 SV=2 18 103 2.0E-50
sp|Q4R362|H4_MACFA Histone H4 OS=Macaca fascicularis GN=QtsA-19327 PE=3 SV=1 18 103 2.0E-50
sp|P62805|H4_HUMAN Histone H4 OS=Homo sapiens GN=HIST1H4A PE=1 SV=2 18 103 2.0E-50
sp|P62801|H4_CHICK Histone H4 OS=Gallus gallus GN=H4-I PE=1 SV=2 18 103 2.0E-50
sp|Q7KQD1|H4_CHAVR Histone H4 OS=Chaetopterus variopedatus PE=3 SV=3 18 103 2.0E-50
sp|P62800|H4_CAIMO Histone H4 OS=Cairina moschata PE=3 SV=2 18 103 2.0E-50
sp|P62803|H4_BOVIN Histone H4 OS=Bos taurus PE=1 SV=2 18 103 2.0E-50
sp|P27996|H4_SOLST Histone H4 OS=Solaster stimpsoni PE=3 SV=2 18 103 2.0E-50
sp|P84045|H4_TIGCA Histone H4 OS=Tigriopus californicus GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P84050|H4_RHYAM Histone H4 OS=Rhynchosciara americana GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P84049|H4_MYRRU Histone H4 OS=Myrmica ruginodis GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P84044|H4_DROYA Histone H4 OS=Drosophila yakuba GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|Q76FF5|H4_DROTE Histone H4 OS=Drosophila teissieri GN=His4 PE=3 SV=3 18 103 2.0E-50
sp|P84043|H4_DROSI Histone H4 OS=Drosophila simulans GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|Q76FD9|H4_DROSE Histone H4 OS=Drosophila sechellia GN=His4 PE=3 SV=3 18 103 2.0E-50
sp|Q76FF1|H4_DROOR Histone H4 OS=Drosophila orena GN=His4 PE=3 SV=3 18 103 2.0E-50
sp|P84040|H4_DROME Histone H4 OS=Drosophila melanogaster GN=His4 PE=1 SV=2 18 103 2.0E-50
sp|Q76FE7|H4_DROMA Histone H4 OS=Drosophila mauritiana GN=His4 PE=3 SV=3 18 103 2.0E-50
sp|P84042|H4_DROHY Histone H4 OS=Drosophila hydei GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P84041|H4_DROER Histone H4 OS=Drosophila erecta GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P84046|H4_CHITH Histone H4 OS=Chironomus thummi thummi GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P84047|H4_ASEAQ Histone H4 OS=Asellus aquaticus GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P84048|H4_ACRAS Histone H4 OS=Acrolepiopsis assectella GN=His4 PE=3 SV=2 18 103 2.0E-50
sp|P02309|H4_YEAST Histone H4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HHF1 PE=1 SV=2 18 103 3.0E-50
sp|Q75AX1|H42_ASHGO Histone H4.2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HHF2 PE=3 SV=4 18 103 4.0E-50
sp|Q757K0|H41_ASHGO Histone H4.1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HHF1 PE=3 SV=3 18 103 4.0E-50
sp|Q6WV74|H4_MYTCH Histone H4 OS=Mytilus chilensis PE=3 SV=3 18 103 4.0E-50
sp|Q6ZXX3|H4_USTMA Histone H4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HHF1 PE=3 SV=4 18 103 6.0E-50
sp|P62783|H4_STRPU Histone H4 OS=Strongylocentrotus purpuratus PE=3 SV=2 18 103 6.0E-50
sp|P62779|H4_PYCHE Histone H4 OS=Pycnopodia helianthoides PE=3 SV=2 18 103 6.0E-50
sp|P62781|H4_PSAMI Histone H4 OS=Psammechinus miliaris PE=1 SV=2 18 103 6.0E-50
sp|P62778|H4_PISOC Histone H4 OS=Pisaster ochraceus PE=3 SV=2 18 103 6.0E-50
sp|P62777|H4_PISBR Histone H4 OS=Pisaster brevispinus PE=3 SV=2 18 103 6.0E-50
sp|P62780|H4_PARLI Histone H4 OS=Paracentrotus lividus PE=3 SV=2 18 103 6.0E-50
sp|P62782|H4_LYTPI Histone H4 OS=Lytechinus pictus PE=3 SV=2 18 103 6.0E-50
sp|P62776|H4_HOLTU Histone H4 OS=Holothuria tubulosa PE=3 SV=2 18 103 6.0E-50
sp|P62784|H4_CAEEL Histone H4 OS=Caenorhabditis elegans GN=his-1 PE=1 SV=2 18 103 6.0E-50
sp|P0CG89|H4_SOYBN Histone H4 OS=Glycine max PE=3 SV=1 18 103 6.0E-50
sp|Q76H85|H4_SILLA Histone H4 OS=Silene latifolia GN=SlH4 PE=3 SV=3 18 103 6.0E-50
sp|P62788|H4_PEA Histone H4 OS=Pisum sativum PE=1 SV=2 18 103 6.0E-50
sp|P62787|H4_MAIZE Histone H4 OS=Zea mays GN=H4C7 PE=1 SV=2 18 103 6.0E-50
sp|P62887|H4_LOLTE Histone H4 OS=Lolium temulentum PE=3 SV=2 18 103 6.0E-50
sp|Q6LAF3|H4_FLATR Histone H4 OS=Flaveria trinervia GN=hh4 PE=3 SV=3 18 103 6.0E-50
sp|Q6WZ83|H4_EUCGL Histone H4 OS=Eucalyptus globulus PE=3 SV=3 18 103 6.0E-50
sp|Q6PMI5|H4_CHEMJ Histone H4 OS=Chelidonium majus PE=3 SV=3 18 103 6.0E-50
sp|P59259|H4_ARATH Histone H4 OS=Arabidopsis thaliana GN=At1g07660 PE=1 SV=2 18 103 6.0E-50
sp|P62786|H42_WHEAT Histone H4 variant TH091 OS=Triticum aestivum PE=3 SV=2 18 103 6.0E-50
sp|P62785|H41_WHEAT Histone H4 variant TH011 OS=Triticum aestivum PE=3 SV=2 18 103 6.0E-50
sp|P70081|H48_CHICK Histone H4 type VIII OS=Gallus gallus GN=H4-VIII PE=3 SV=3 18 103 1.0E-49
sp|P82888|H4_OLILU Histone H4 OS=Olisthodiscus luteus PE=1 SV=2 18 103 1.0E-49
sp|Q8MTV8|H4_APLCA Histone H4 OS=Aplysia californica GN=His.H4 PE=3 SV=3 18 103 1.0E-49
sp|Q43083|H4_PYRSA Histone H4 OS=Pyrenomonas salina PE=3 SV=3 18 103 1.0E-49
sp|P35057|H4_SOLLC Histone H4 OS=Solanum lycopersicum PE=3 SV=2 18 103 2.0E-49
sp|Q6V9I2|H4_SOLCH Histone H4 OS=Solanum chacoense PE=3 SV=3 18 103 2.0E-49
sp|Q71V09|H4_CAPAN Histone H4 OS=Capsicum annuum PE=3 SV=3 18 103 2.0E-49
sp|P50566|H4_CHLRE Histone H4 OS=Chlamydomonas reinhardtii GN=H4-I PE=3 SV=2 18 103 2.0E-49
sp|P91882|H4_DIAPU Histone H4 OS=Diadromus pulchellus PE=3 SV=3 18 103 2.0E-49
sp|P91890|H4_TRICD Histone H4 OS=Trichogramma cacoeciae PE=3 SV=3 18 103 3.0E-49
sp|P62792|H4_PHACH Histone H4 OS=Phanerochaete chrysosporium GN=H4.1 PE=3 SV=2 18 103 3.0E-49
sp|P62793|H4_AGABI Histone H4 OS=Agaricus bisporus GN=hhfA PE=3 SV=2 18 103 3.0E-49
sp|P08436|H4_VOLCA Histone H4 OS=Volvox carteri GN=H4-I PE=3 SV=2 18 103 6.0E-49
sp|Q41811|H43_MAIZE Histone H4.3 OS=Zea mays GN=H4 PE=1 SV=3 18 103 1.0E-48
sp|Q27443|H4_ASCSU Histone H4 OS=Ascaris suum PE=3 SV=2 18 103 1.0E-48
sp|P83865|H4_LITVA Histone H4 OS=Litopenaeus vannamei PE=1 SV=2 18 103 1.0E-47
sp|Q8T7J8|H4_EIMTE Histone H4 OS=Eimeria tenella PE=3 SV=3 18 103 2.0E-47
sp|P91849|H4_APIME Histone H4 OS=Apis mellifera PE=3 SV=3 18 103 3.0E-47
sp|P80739|H4_EUPCR Histone H4 OS=Euplotes crassus PE=1 SV=3 18 103 3.0E-43
sp|Q76NW2|H4_DICDI Histone H4 OS=Dictyostelium discoideum GN=H4a PE=1 SV=1 16 103 1.0E-41
sp|P69152|H4_TETTS Histone H4 OS=Tetrahymena thermophila (strain SB210) GN=HHF1 PE=1 SV=2 18 103 2.0E-41
sp|P69151|H42_TETPY Histone H4, minor OS=Tetrahymena pyriformis PE=1 SV=2 18 103 2.0E-41
sp|P90516|H42_BLEJA Histone H4 (Fragment) OS=Blepharisma japonicum GN=H4 PE=3 SV=1 9 95 4.0E-41
sp|P02310|H41_TETPY Histone H4, major OS=Tetrahymena pyriformis PE=1 SV=2 26 103 6.0E-41
sp|P40287|H4_ENTHI Histone H4 OS=Entamoeba histolytica PE=3 SV=1 3 102 1.0E-40
sp|P80737|H41_BLEJA Histone H4-1 (Fragment) OS=Blepharisma japonicum PE=1 SV=3 18 95 6.0E-39
sp|Q99525|H4G_HUMAN Histone H4-like protein type G OS=Homo sapiens GN=HIST1H4G PE=1 SV=1 19 98 4.0E-34
sp|Q8SQP4|H4_ENCCU Histone H4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HHF1 PE=3 SV=1 5 101 2.0E-16
sp|P80738|H4Y_BLEJA Histone H4 (Fragment) OS=Blepharisma japonicum PE=1 SV=2 18 45 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006352 DNA-templated transcription, initiation Yes
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6567
MTGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLKTFLEGVIRDAVTYTE
HAKRKTVTSLDVVYALKRQGRTLYGFGG*
Coding >OphauB2|6567
ATGACTGGACGTGGCAAGGGTGGCAAGGGCCTTGGCAAAGGTGGCGCTAAGCGTCACCGCAAGATTTTGCGAGAC
AACATTCAAGGAATTACCAAGCCCGCTATCCGTCGTCTGGCTCGCCGTGGCGGTGTCAAGCGTATCTCTGCCATG
ATTTACGAAGAGACTCGTGGTGTCCTCAAGACCTTCCTCGAGGGTGTCATCCGTGATGCCGTCACCTACACTGAG
CACGCCAAGCGCAAGACGGTCACGTCGCTCGACGTTGTCTATGCCCTCAAGCGCCAGGGCCGCACTCTGTACGGT
TTCGGTGGTTAG
Transcript >OphauB2|6567
ATGACTGGACGTGGCAAGGGTGGCAAGGGCCTTGGCAAAGGTGGCGCTAAGCGTCACCGCAAGATTTTGCGAGAC
AACATTCAAGGAATTACCAAGCCCGCTATCCGTCGTCTGGCTCGCCGTGGCGGTGTCAAGCGTATCTCTGCCATG
ATTTACGAAGAGACTCGTGGTGTCCTCAAGACCTTCCTCGAGGGTGTCATCCGTGATGCCGTCACCTACACTGAG
CACGCCAAGCGCAAGACGGTCACGTCGCTCGACGTTGTCTATGCCCTCAAGCGCCAGGGCCGCACTCTGTACGGT
TTCGGTGGTTAG
Gene >OphauB2|6567
ATGACTGGACGTAAGTATAGTAATATATATACTTTTTTTGCTTTGTTTTTATGGGTCTTTATCGGAGGCGTTCCA
GTTTGTCATCGCCATGGGCGCTCCTCAAGATGCCGACCGAGCGATAAACGCGTCGTTTGATTGAGGCTTGAGTGT
CAACACGAATGCTAACATGATGTGGCATAGGTGGCAAGGGTGGCAAGGGCCTTGGCAAAGGTGGCGCTAAGCGTC
ACCGCAAGATTTTGCGAGACAACATTCAAGGAATTACCAAGCCCGCTATCCGTCGTCTGGCTCGCCGTGGCGGTG
TCAAGCGTATCTCTGCCAGTAAGTTTGGACAATTATTTGCGCCATTTGTGAAACACAATCATCTAACGCGTTGCC
TCCTAGTGATTTACGAAGAGACTCGTGGTGTCCTCAAGACCTTCCTCGAGGGTGTCATCCGTGATGCCGTCACCT
ACACTGAGCACGCCAAGCGCAAGACGGTCACGTCGCTCGACGTTGTCTATGCCCTCAAGCGCCAGGGCCGCACTC
TGTACGGTTTCGGTGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail