Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6564
Gene name
LocationContig_60:57500..57986
Strand-
Gene length (bp)486
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05620 TMEM208_SND2 SRP-independent targeting protein 2/TMEM208 5.4E-52 1 159

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14193|MUG69_SCHPO Meiotically up-regulated gene 69 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug69 PE=1 SV=4 1 126 1.0E-09
sp|Q99382|ENV10_YEAST Late endosome and vacuole interface protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENV10 PE=1 SV=1 1 159 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 44 66 22
3 87 109 22
4 113 135 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6564
MAQKAKKDQAKNNAAALSRLHLTSLALNLVFLLFRFALAPSRSLVAYVVLSIPAFACQYALEAAGRPRFDAASGA
LRTAGQDLAAPGLTEYMFDVIWVTWGCLFAVIFAGNWAWLLWAVIPAYGVYLGSGLLGLGRQKMAQMQADGQPGP
SQGNRRSRRAA*
Coding >OphauB2|6564
ATGGCGCAAAAGGCCAAGAAGGACCAGGCCAAGAACAATGCCGCCGCGCTAAGTCGCCTGCATCTGACTTCGCTC
GCCCTCAACCTCGTCTTCCTGCTCTTTCGCTTCGCCCTGGCCCCGTCCCGTTCACTCGTCGCCTACGTCGTCTTG
TCCATACCAGCGTTTGCCTGCCAGTATGCCCTTGAAGCTGCTGGTCGGCCGCGATTCGATGCTGCCTCGGGCGCT
CTCAGGACTGCAGGCCAAGACTTGGCCGCCCCGGGCTTGACCGAGTACATGTTTGACGTCATCTGGGTCACTTGG
GGCTGCCTCTTCGCCGTCATTTTTGCCGGCAATTGGGCCTGGCTACTCTGGGCCGTAATTCCCGCCTATGGCGTC
TACCTTGGCTCTGGCCTGCTGGGCTTGGGGCGCCAGAAAATGGCCCAGATGCAGGCCGACGGCCAGCCGGGCCCT
TCTCAGGGCAATCGACGGTCAAGAAGAGCTGCTTGA
Transcript >OphauB2|6564
ATGGCGCAAAAGGCCAAGAAGGACCAGGCCAAGAACAATGCCGCCGCGCTAAGTCGCCTGCATCTGACTTCGCTC
GCCCTCAACCTCGTCTTCCTGCTCTTTCGCTTCGCCCTGGCCCCGTCCCGTTCACTCGTCGCCTACGTCGTCTTG
TCCATACCAGCGTTTGCCTGCCAGTATGCCCTTGAAGCTGCTGGTCGGCCGCGATTCGATGCTGCCTCGGGCGCT
CTCAGGACTGCAGGCCAAGACTTGGCCGCCCCGGGCTTGACCGAGTACATGTTTGACGTCATCTGGGTCACTTGG
GGCTGCCTCTTCGCCGTCATTTTTGCCGGCAATTGGGCCTGGCTACTCTGGGCCGTAATTCCCGCCTATGGCGTC
TACCTTGGCTCTGGCCTGCTGGGCTTGGGGCGCCAGAAAATGGCCCAGATGCAGGCCGACGGCCAGCCGGGCCCT
TCTCAGGGCAATCGACGGTCAAGAAGAGCTGCTTGA
Gene >OphauB2|6564
ATGGCGCAAAAGGCCAAGAAGGACCAGGCCAAGAACAATGCCGCCGCGCTAAGTCGCCTGCATCTGACTTCGCTC
GCCCTCAACCTCGTCTTCCTGCTCTTTCGCTTCGCCCTGGCCCCGTCCCGTTCACTCGTCGCCTACGTCGTCTTG
TCCATACCAGCGTTTGCCTGCCAGTATGCCCTTGAAGCTGCTGGTCGGCCGCGATTCGATGCTGCCTCGGGCGCT
CTCAGGACTGCAGGCCAAGACTTGGCCGCCCCGGGCTTGACCGAGTACATGTTTGACGTCATCTGGGTCACTTGG
GGCTGCCTCTTCGCCGTCATTTTTGCCGGCAATTGGGCCTGGCTACTCTGGGCCGTAATTCCCGCCTATGGCGTC
TACCTTGGCTCTGGCCTGCTGGGCTTGGGGCGCCAGAAAATGGCCCAGATGCAGGCCGACGGCCAGCCGGGCCCT
TCTCAGGGCAATCGACGGTCAAGAAGAGCTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail