Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6562
Gene name
LocationContig_60:54807..55828
Strand-
Gene length (bp)1021
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10340 Say1_Mug180 Steryl acetyl hydrolase 9.7E-20 16 265
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.9E-18 31 260
PF20434 BD-FAE BD-FAE 5.1E-07 24 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54310|LIPS_MOUSE Hormone-sensitive lipase OS=Mus musculus GN=Lipe PE=1 SV=2 16 128 2.0E-10
sp|Q68J42|LIPS_PIG Hormone-sensitive lipase OS=Sus scrofa GN=LIPE PE=2 SV=1 14 128 2.0E-10
sp|P15304|LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus GN=Lipe PE=1 SV=3 16 128 2.0E-10
sp|Q05469|LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens GN=LIPE PE=1 SV=4 16 128 4.0E-10
sp|P16386|LIPS_BOVIN Hormone-sensitive lipase OS=Bos taurus GN=LIPE PE=1 SV=2 14 128 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54310|LIPS_MOUSE Hormone-sensitive lipase OS=Mus musculus GN=Lipe PE=1 SV=2 16 128 2.0E-10
sp|Q68J42|LIPS_PIG Hormone-sensitive lipase OS=Sus scrofa GN=LIPE PE=2 SV=1 14 128 2.0E-10
sp|P15304|LIPS_RAT Hormone-sensitive lipase OS=Rattus norvegicus GN=Lipe PE=1 SV=3 16 128 2.0E-10
sp|Q05469|LIPS_HUMAN Hormone-sensitive lipase OS=Homo sapiens GN=LIPE PE=1 SV=4 16 128 4.0E-10
sp|P16386|LIPS_BOVIN Hormone-sensitive lipase OS=Bos taurus GN=LIPE PE=1 SV=2 14 128 6.0E-10
sp|Q9R101|LIPS_ICTTR Hormone-sensitive lipase OS=Ictidomys tridecemlineatus GN=LIPE PE=2 SV=1 16 128 9.0E-09
sp|Q5R8Y5|NCEH1_PONAB Neutral cholesterol ester hydrolase 1 OS=Pongo abelii GN=NCEH1 PE=2 SV=1 22 120 4.0E-07
sp|Q6PIU2|NCEH1_HUMAN Neutral cholesterol ester hydrolase 1 OS=Homo sapiens GN=NCEH1 PE=1 SV=3 22 120 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6562
MTSTDQIQAGTYVKGIWIRQDPKQTPDVVIYYVNGGGFALGTCHFYLEFLLVWHHLLLNAGYKNPAIFALEYTLV
PEATYPTQVSETMLGWKHALQMVNGDGSRICVAGDSAGGTLILSLLLQLGAQGGSSGSAAQSPQGGLMPSNGDTI
MPQLAVLVSPWVTLTTKLHYPSKVDYLNRETLWQYAHAYAGSAMINQPPASPGSCVDEKLWLAASPRGGYVVFVG
SEEVLAPDIEHFVEHQTRINTRVKTLRMERGVHAWPIAAMYLATSMDLRLHWLKAMTNEISLLIPTEASEKKEKK
TAAFRLDQVNIHRQP*
Coding >OphauB2|6562
ATGACGTCGACTGACCAGATCCAGGCTGGCACATATGTCAAGGGCATATGGATCAGGCAGGACCCAAAGCAAACT
CCTGATGTTGTGATTTATTATGTCAACGGCGGGGGCTTCGCACTGGGAACCTGCCATTTTTATCTCGAATTCCTA
TTGGTCTGGCATCACCTTTTGCTCAACGCTGGATACAAAAACCCAGCAATATTCGCACTCGAGTACACTTTGGTA
CCAGAAGCGACCTATCCAACTCAAGTTTCGGAAACGATGCTAGGTTGGAAGCACGCCTTACAAATGGTCAATGGT
GATGGCTCTCGAATATGTGTCGCTGGAGACTCGGCTGGAGGTACTCTGATACTCAGTCTGCTTCTTCAACTCGGC
GCTCAAGGCGGCAGCTCGGGCTCGGCTGCACAGAGTCCTCAAGGTGGTCTAATGCCTTCAAATGGTGACACCATC
ATGCCCCAGTTAGCCGTGCTAGTGTCGCCATGGGTTACGCTCACGACAAAGCTTCACTATCCCTCCAAGGTGGAC
TACTTGAACCGGGAAACCCTTTGGCAGTATGCTCACGCCTACGCGGGAAGCGCAATGATCAACCAGCCGCCCGCA
TCGCCAGGGTCTTGCGTTGATGAAAAGCTTTGGTTGGCAGCAAGCCCGCGGGGCGGCTACGTTGTTTTTGTTGGT
TCAGAAGAAGTCTTGGCGCCGGATATCGAGCATTTCGTGGAGCATCAAACCCGGATTAACACCAGGGTCAAAACA
CTGCGCATGGAAAGGGGTGTGCATGCGTGGCCGATAGCGGCCATGTACTTGGCAACGTCGATGGACTTGAGGCTG
CACTGGCTCAAAGCCATGACAAATGAGATTAGCTTGCTGATCCCCACGGAAGCTTCAGAGAAGAAGGAAAAAAAG
ACAGCGGCTTTCAGATTAGATCAAGTAAATATTCATAGACAACCATAG
Transcript >OphauB2|6562
ATGACGTCGACTGACCAGATCCAGGCTGGCACATATGTCAAGGGCATATGGATCAGGCAGGACCCAAAGCAAACT
CCTGATGTTGTGATTTATTATGTCAACGGCGGGGGCTTCGCACTGGGAACCTGCCATTTTTATCTCGAATTCCTA
TTGGTCTGGCATCACCTTTTGCTCAACGCTGGATACAAAAACCCAGCAATATTCGCACTCGAGTACACTTTGGTA
CCAGAAGCGACCTATCCAACTCAAGTTTCGGAAACGATGCTAGGTTGGAAGCACGCCTTACAAATGGTCAATGGT
GATGGCTCTCGAATATGTGTCGCTGGAGACTCGGCTGGAGGTACTCTGATACTCAGTCTGCTTCTTCAACTCGGC
GCTCAAGGCGGCAGCTCGGGCTCGGCTGCACAGAGTCCTCAAGGTGGTCTAATGCCTTCAAATGGTGACACCATC
ATGCCCCAGTTAGCCGTGCTAGTGTCGCCATGGGTTACGCTCACGACAAAGCTTCACTATCCCTCCAAGGTGGAC
TACTTGAACCGGGAAACCCTTTGGCAGTATGCTCACGCCTACGCGGGAAGCGCAATGATCAACCAGCCGCCCGCA
TCGCCAGGGTCTTGCGTTGATGAAAAGCTTTGGTTGGCAGCAAGCCCGCGGGGCGGCTACGTTGTTTTTGTTGGT
TCAGAAGAAGTCTTGGCGCCGGATATCGAGCATTTCGTGGAGCATCAAACCCGGATTAACACCAGGGTCAAAACA
CTGCGCATGGAAAGGGGTGTGCATGCGTGGCCGATAGCGGCCATGTACTTGGCAACGTCGATGGACTTGAGGCTG
CACTGGCTCAAAGCCATGACAAATGAGATTAGCTTGCTGATCCCCACGGAAGCTTCAGAGAAGAAGGAAAAAAAG
ACAGCGGCTTTCAGATTAGATCAAGTAAATATTCATAGACAACCATAG
Gene >OphauB2|6562
ATGACGTCGACTGACCAGATCCAGGCTGGCACATATGTCAAGGGCATATGGATCAGGCAGGACCCAAAGCAAACT
CCTGATGTTGTGATTTATTATGTCAACGGTATGCACGTTACATGGCCGTTTATATTGTGTCCGATCTTCGAAACT
AATTACTCAAATTGAAATTCATCAAGGCGGGGGCTTCGCACTGGGAACCTGCCATTTTTATCTCGAATTCCTATT
GGTCTGGCATCACCTTTTGCTCAACGCTGGATACAAAAACCCAGCAATATTCGCACTCGAGTACACTTTGGTACC
AGAAGCGACCTATCCAACTCAAGTTTCGGAAACGATGCTAGGTTGGAAGCACGCCTTACAAATGGTCAATGGTGA
TGGCTCTCGAATATGTGTCGCTGGAGACTCGGCTGGAGGTACTCTGATACTCAGTCTGCTTCTTCAACTCGGCGC
TCAAGGCGGCAGCTCGGGCTCGGCTGCACAGAGTCCTCAAGGTGGTCTAATGCCTTCAAATGGTGACACCATCAT
GCCCCAGTTAGCCGTGCTAGTGTCGCCATGGGTTACGCTCACGACAAAGCTTCACTATCCCTCCAAGGTGGACTA
CTTGAACCGGGAAACCCTTTGGCAGTATGCTCACGCCTACGCGGGAAGCGCAATGATCAACCAGCCGCCCGCATC
GCCAGGGTCTTGCGTTGATGAAAAGCTTTGGTTGGCAGCAAGCCCGCGGGGCGGCTACGTTGTTTTTGTTGGTTC
AGAAGAAGTCTTGGCGCCGGATATCGAGCATTTCGTGGAGCATCAAACCCGGATTAACACCAGGGTCAAAACACT
GCGCATGGAAAGGGGTGTGCATGCGTGGCCGATAGCGGCCATGTACTTGGCAACGTCGATGGACTTGAGGCTGCA
CTGGCTCAAAGCCATGACAAATGAGATTAGCTTGCTGATCCCCACGGAAGCTTCAGAGAAGAAGGAAAAAAAGAC
AGCGGCTTTCAGATTAGATCAAGTAAATATTCATAGACAACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail