Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6561
Gene name
LocationContig_60:52349..53360
Strand-
Gene length (bp)1011
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 1.4E-12 220 282

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6M5|DPB3_YARLI DNA polymerase epsilon subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB3 PE=3 SV=1 213 328 3.0E-23
sp|Q14919|NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens GN=DRAP1 PE=1 SV=3 220 333 1.0E-22
sp|A0JPP1|NC2A_RAT Dr1-associated corepressor OS=Rattus norvegicus GN=Drap1 PE=2 SV=1 220 305 3.0E-22
sp|Q2YDP3|NC2A_BOVIN Dr1-associated corepressor OS=Bos taurus GN=DRAP1 PE=2 SV=1 220 305 5.0E-22
sp|Q9D6N5|NC2A_MOUSE Dr1-associated corepressor OS=Mus musculus GN=Drap1 PE=1 SV=3 220 305 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6M5|DPB3_YARLI DNA polymerase epsilon subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB3 PE=3 SV=1 213 328 3.0E-23
sp|Q14919|NC2A_HUMAN Dr1-associated corepressor OS=Homo sapiens GN=DRAP1 PE=1 SV=3 220 333 1.0E-22
sp|A0JPP1|NC2A_RAT Dr1-associated corepressor OS=Rattus norvegicus GN=Drap1 PE=2 SV=1 220 305 3.0E-22
sp|Q2YDP3|NC2A_BOVIN Dr1-associated corepressor OS=Bos taurus GN=DRAP1 PE=2 SV=1 220 305 5.0E-22
sp|Q9D6N5|NC2A_MOUSE Dr1-associated corepressor OS=Mus musculus GN=Drap1 PE=1 SV=3 220 305 5.0E-22
sp|P40096|NCB1_YEAST Negative cofactor 2 complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUR6 PE=1 SV=1 217 294 6.0E-21
sp|Q10315|DPB3_SCHPO DNA polymerase epsilon subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb3 PE=1 SV=1 218 299 2.0E-20
sp|Q54DA1|NC2A_DICDI Dr1-associated corepressor homolog OS=Dictyostelium discoideum GN=drap1 PE=3 SV=1 218 311 3.0E-20
sp|Q9FMV5|NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1 220 310 6.0E-09
sp|Q9ZVL3|NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana GN=NFYC3 PE=2 SV=1 221 312 8.0E-09
sp|Q8LCG7|NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana GN=NFYC2 PE=2 SV=2 221 305 2.0E-08
sp|Q02516|HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1 221 298 3.0E-08
sp|Q8L4B2|NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana GN=NFYC9 PE=2 SV=1 221 304 3.0E-08
sp|Q9SMP0|NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1 220 304 5.0E-08
sp|Q9FGP7|NFYC6_ARATH Nuclear transcription factor Y subunit C-6 OS=Arabidopsis thaliana GN=NFYC6 PE=2 SV=1 220 296 2.0E-07
sp|Q13952|NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens GN=NFYC PE=1 SV=3 220 302 6.0E-07
sp|Q62725|NFYC_RAT Nuclear transcription factor Y subunit gamma OS=Rattus norvegicus GN=Nfyc PE=2 SV=1 220 302 5.0E-06
sp|P70353|NFYC_MOUSE Nuclear transcription factor Y subunit gamma OS=Mus musculus GN=Nfyc PE=1 SV=2 220 302 5.0E-06
sp|Q5RA23|NFYC_PONAB Nuclear transcription factor Y subunit gamma OS=Pongo abelii GN=NFYC PE=2 SV=1 220 302 5.0E-06
sp|Q5E9X1|NFYC_BOVIN Nuclear transcription factor Y subunit gamma OS=Bos taurus GN=NFYC PE=2 SV=1 220 302 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6561
MSADESNSTSGYAPKSPDLSSFYSASPTLPASQQVGHPSLEQQQGEGYKEQRLANPYSSSAFPSTSVYTPPTLTF
PTSHPIFVPEWRCHPPPSAYSAQQQYYHSSSALPPFNHPSRTPYGYREPLAGQRQEHQQPPPPDQEEIAHYRQQP
IQPGLSLIPGASVTSPSSTGSADMPPRRRAAAAAAAAVAAEAAASSSSPPPSPPLPPSAPAVEPSPVKTKFPTAR
IKRIMQADEEVGKVAQQAPIAVGKALELFMVQLVNRGAEVARNKGARKVTAAMLKQVIETEEQWDFLREIVSRVD
LEKDGSRAKAKTESESDEEVVEPKRRGRGGGRKKKE*
Coding >OphauB2|6561
ATGTCGGCAGACGAGTCCAATTCCACGTCGGGCTACGCGCCAAAGTCGCCAGACCTGTCGTCCTTTTACTCGGCC
AGCCCCACTTTGCCCGCATCACAACAAGTCGGCCATCCGAGCCTTGAGCAACAGCAGGGAGAAGGCTATAAAGAG
CAACGTCTCGCCAATCCATATTCTTCGTCGGCTTTTCCCTCAACCTCGGTTTACACCCCCCCAACCCTCACTTTC
CCCACCAGCCACCCTATATTTGTCCCAGAGTGGCGCTGTCATCCACCGCCGTCTGCTTATAGCGCGCAGCAGCAG
TACTATCATTCTTCCTCTGCGCTGCCGCCCTTTAATCACCCATCCCGGACGCCATACGGCTACAGGGAACCTCTT
GCTGGGCAGCGGCAGGAGCACCAACAGCCGCCGCCGCCTGACCAAGAAGAAATAGCTCATTACAGGCAACAGCCT
ATTCAACCGGGCTTGTCCTTAATTCCTGGCGCCTCTGTCACCAGTCCCTCATCCACTGGCAGTGCCGACATGCCA
CCACGAAGACGAGCTGCTGCCGCCGCCGCCGCCGCCGTGGCTGCTGAAGCGGCTGCTTCTTCATCATCCCCTCCC
CCCTCACCGCCTCTTCCGCCTTCTGCCCCTGCGGTGGAGCCGTCACCTGTCAAGACAAAGTTCCCGACGGCCAGG
ATAAAGCGCATCATGCAGGCCGACGAAGAAGTGGGCAAAGTTGCCCAGCAAGCACCAATTGCCGTGGGAAAAGCT
CTTGAACTTTTCATGGTCCAGCTCGTCAATAGGGGCGCCGAGGTGGCCAGGAACAAGGGAGCTCGAAAGGTGACG
GCCGCAATGCTCAAGCAAGTCATTGAGACGGAGGAGCAATGGGACTTTCTTCGCGAAATCGTCAGCCGCGTCGAT
CTCGAAAAGGATGGCTCACGGGCCAAGGCCAAGACGGAGAGCGAGAGCGACGAAGAAGTGGTGGAGCCTAAGAGA
CGCGGACGCGGCGGAGGACGCAAGAAGAAGGAGTAG
Transcript >OphauB2|6561
ATGTCGGCAGACGAGTCCAATTCCACGTCGGGCTACGCGCCAAAGTCGCCAGACCTGTCGTCCTTTTACTCGGCC
AGCCCCACTTTGCCCGCATCACAACAAGTCGGCCATCCGAGCCTTGAGCAACAGCAGGGAGAAGGCTATAAAGAG
CAACGTCTCGCCAATCCATATTCTTCGTCGGCTTTTCCCTCAACCTCGGTTTACACCCCCCCAACCCTCACTTTC
CCCACCAGCCACCCTATATTTGTCCCAGAGTGGCGCTGTCATCCACCGCCGTCTGCTTATAGCGCGCAGCAGCAG
TACTATCATTCTTCCTCTGCGCTGCCGCCCTTTAATCACCCATCCCGGACGCCATACGGCTACAGGGAACCTCTT
GCTGGGCAGCGGCAGGAGCACCAACAGCCGCCGCCGCCTGACCAAGAAGAAATAGCTCATTACAGGCAACAGCCT
ATTCAACCGGGCTTGTCCTTAATTCCTGGCGCCTCTGTCACCAGTCCCTCATCCACTGGCAGTGCCGACATGCCA
CCACGAAGACGAGCTGCTGCCGCCGCCGCCGCCGCCGTGGCTGCTGAAGCGGCTGCTTCTTCATCATCCCCTCCC
CCCTCACCGCCTCTTCCGCCTTCTGCCCCTGCGGTGGAGCCGTCACCTGTCAAGACAAAGTTCCCGACGGCCAGG
ATAAAGCGCATCATGCAGGCCGACGAAGAAGTGGGCAAAGTTGCCCAGCAAGCACCAATTGCCGTGGGAAAAGCT
CTTGAACTTTTCATGGTCCAGCTCGTCAATAGGGGCGCCGAGGTGGCCAGGAACAAGGGAGCTCGAAAGGTGACG
GCCGCAATGCTCAAGCAAGTCATTGAGACGGAGGAGCAATGGGACTTTCTTCGCGAAATCGTCAGCCGCGTCGAT
CTCGAAAAGGATGGCTCACGGGCCAAGGCCAAGACGGAGAGCGAGAGCGACGAAGAAGTGGTGGAGCCTAAGAGA
CGCGGACGCGGCGGAGGACGCAAGAAGAAGGAGTAG
Gene >OphauB2|6561
ATGTCGGCAGACGAGTCCAATTCCACGTCGGGCTACGCGCCAAAGTCGCCAGACCTGTCGTCCTTTTACTCGGCC
AGCCCCACTTTGCCCGCATCACAACAAGTCGGCCATCCGAGCCTTGAGCAACAGCAGGGAGAAGGCTATAAAGAG
CAACGTCTCGCCAATCCATATTCTTCGTCGGCTTTTCCCTCAACCTCGGTTTACACCCCCCCAACCCTCACTTTC
CCCACCAGCCACCCTATATTTGTCCCAGAGTGGCGCTGTCATCCACCGCCGTCTGCTTATAGCGCGCAGCAGCAG
TACTATCATTCTTCCTCTGCGCTGCCGCCCTTTAATCACCCATCCCGGACGCCATACGGCTACAGGGAACCTCTT
GCTGGGCAGCGGCAGGAGCACCAACAGCCGCCGCCGCCTGACCAAGAAGAAATAGCTCATTACAGGCAACAGCCT
ATTCAACCGGGCTTGTCCTTAATTCCTGGCGCCTCTGTCACCAGTCCCTCATCCACTGGCAGTGCCGACATGCCA
CCACGAAGACGAGCTGCTGCCGCCGCCGCCGCCGCCGTGGCTGCTGAAGCGGCTGCTTCTTCATCATCCCCTCCC
CCCTCACCGCCTCTTCCGCCTTCTGCCCCTGCGGTGGAGCCGTCACCTGTCAAGACAAAGTTCCCGACGGCCAGG
ATAAAGCGCATCATGCAGGCCGACGAAGAAGTGGGCAAAGTTGCCCAGCAAGCACCAATTGCCGTGGGAAAAGCT
CTTGAACTTTTCATGGTCCAGCTCGTCAATAGGGGCGCCGAGGTGGCCAGGAACAAGGGAGCTCGAAAGGTGACG
GCCGCAATGCTCAAGCAAGTCATTGAGACGGAGGAGCAATGGGACTTTCTTCGCGAAATCGTCAGCCGCGTCGAT
CTCGAAAAGGATGGCTCACGGGCCAAGGCCAAGACGGAGAGCGAGAGCGACGAAGAAGTGGTGGAGCCTAAGAGA
CGCGGACGCGGCGGAGGACGCAAGAAGAAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail