Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6552
Gene name
LocationContig_60:21770..23890
Strand+
Gene length (bp)2120
Transcript length (bp)2067
Coding sequence length (bp)2067
Protein length (aa) 689

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12936 Kri1_C KRI1-like family C-terminal 2.5E-26 508 605
PF05178 Kri1 KRI1-like family 5.9E-26 332 457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09799|KRI1_SCHPO Protein kri1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kri1 PE=1 SV=1 37 610 7.0E-41
sp|P42846|KRI1_YEAST Protein KRI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRI1 PE=1 SV=1 95 611 1.0E-34
sp|Q0V8M0|KRI1_BOVIN Protein KRI1 homolog OS=Bos taurus GN=KRI1 PE=2 SV=3 32 405 6.0E-20
sp|Q8VDQ9|KRI1_MOUSE Protein KRI1 homolog OS=Mus musculus GN=Kri1 PE=1 SV=3 37 405 6.0E-15
sp|Q8N9T8|KRI1_HUMAN Protein KRI1 homolog OS=Homo sapiens GN=KRI1 PE=1 SV=3 38 608 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09799|KRI1_SCHPO Protein kri1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kri1 PE=1 SV=1 37 610 7.0E-41
sp|P42846|KRI1_YEAST Protein KRI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRI1 PE=1 SV=1 95 611 1.0E-34
sp|Q0V8M0|KRI1_BOVIN Protein KRI1 homolog OS=Bos taurus GN=KRI1 PE=2 SV=3 32 405 6.0E-20
sp|Q8VDQ9|KRI1_MOUSE Protein KRI1 homolog OS=Mus musculus GN=Kri1 PE=1 SV=3 37 405 6.0E-15
sp|Q8N9T8|KRI1_HUMAN Protein KRI1 homolog OS=Homo sapiens GN=KRI1 PE=1 SV=3 38 608 1.0E-12
sp|Q6DRJ4|KRI1_DANRE Protein KRI1 homolog OS=Danio rerio GN=kri1 PE=2 SV=1 38 315 6.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6552
MAAKSISETALKLGSEKRTLLDSDSDSDSDNGGAPVSLKVNQEFARRFEHNKKREEIHRLEDKYKNKRQPNKPQD
DASDDKNDSSSSSETEDEDGFLATEDLDAQISATLHAIRTKDPRVYDTNVTFVQLPDDEQPAASTNKKEKPVFLR
DYHRGNLLRGDAGAFDDEKQAPQTYNQEQHDLKRTILSEIKAAESDNDSEDDGIVKRKEPAKPDANGLHPTRAAA
VKSAAVKLSEKDIANADENPDTFLSNFMAARAWIPEEGGKWKAFESDDGDEDDVADEWEQAYNMRFEDPAKSNEV
LKSYARDFAAARSVRREEKTGRRRQRELQRDKKEQDKRQKHEEKARLRKLKVEEAEEKLRKVRQAAGALGQEMTQ
EALVQFLDEAWEDGKWEQEMQKRFGDDYYAMEDDASREEEESEHGSEADEASETRKKKKKKKHPKKPKWDNDIDI
DDIVPDFADDDGKPPISLGDTESTDDEQAGHAAKKRKTLDHKRARLESQRASRRQRAQLEALVDAKLHLSNHDLV
SHTKQSSSSAAAAPAAPFRYRETSPQTFGMTPRDILLAPSDQALNEFAGLKKLAPFRDAERKRRDRKRLGKKARL
REWRRGVFGQEFEREGPTFGFERLVHGLDDCGAPGEREASKHGKKTRRHGADDEAATQGQDNIVGEVGTSRKKRK
RSKGTRSAHAEAS*
Coding >OphauB2|6552
ATGGCTGCCAAATCAATTTCAGAAACGGCCTTGAAACTAGGCTCCGAGAAACGTACTCTGCTCGATAGCGACTCC
GACTCGGACTCTGATAATGGAGGAGCACCTGTCTCTCTCAAGGTGAATCAAGAATTTGCTCGACGATTCGAGCAC
AATAAGAAACGAGAAGAAATTCATAGATTAGAGGACAAATACAAGAACAAGCGCCAGCCCAACAAGCCTCAAGAT
GACGCCTCCGACGACAAAAACGACTCTTCCTCATCGAGCGAGACAGAGGATGAGGACGGATTCCTTGCAACCGAA
GACTTGGATGCCCAAATTTCTGCCACTCTGCATGCCATTCGAACCAAGGACCCCCGCGTCTACGACACAAACGTC
ACCTTTGTCCAGCTTCCCGATGACGAACAACCAGCTGCCTCGACGAATAAGAAGGAGAAGCCCGTGTTTCTACGC
GACTATCACAGGGGAAACCTTTTACGAGGCGATGCCGGCGCTTTTGACGACGAGAAACAAGCCCCCCAAACCTAC
AACCAGGAGCAACATGATTTAAAAAGGACAATCTTGTCGGAGATCAAGGCGGCAGAATCCGACAATGACTCGGAA
GATGACGGAATTGTCAAGCGTAAAGAGCCTGCAAAACCAGACGCAAATGGCCTTCACCCGACGAGGGCTGCGGCC
GTCAAGTCTGCCGCTGTAAAATTATCAGAGAAGGATATCGCCAATGCCGACGAGAACCCAGACACCTTTCTCTCC
AACTTTATGGCTGCTCGGGCCTGGATCCCAGAAGAGGGCGGCAAGTGGAAGGCATTTGAGTCTGACGATGGTGAC
GAAGACGACGTTGCCGACGAGTGGGAGCAGGCTTACAACATGCGGTTTGAAGATCCCGCAAAGAGCAACGAAGTT
TTGAAGTCGTATGCTCGAGACTTTGCCGCAGCCCGGTCGGTGCGCCGCGAAGAAAAGACGGGGAGAAGACGCCAG
CGAGAGCTTCAACGCGACAAGAAGGAGCAAGACAAGCGCCAAAAGCACGAGGAAAAGGCTCGCCTCCGCAAACTC
AAGGTGGAGGAGGCGGAGGAAAAGTTGCGCAAGGTTAGACAGGCGGCAGGTGCTCTCGGGCAAGAAATGACGCAA
GAAGCCTTGGTGCAGTTTCTGGATGAGGCCTGGGAGGATGGCAAGTGGGAGCAAGAAATGCAAAAGAGGTTTGGC
GACGACTACTACGCCATGGAGGATGACGCATCAAGGGAGGAGGAGGAGAGCGAGCATGGCAGCGAGGCAGACGAG
GCAAGCGAGACGAGGAAGAAGAAGAAGAAGAAGAAGCATCCCAAGAAGCCCAAATGGGACAATGACATTGACATT
GACGACATTGTCCCCGACTTTGCCGACGACGACGGCAAGCCTCCCATCAGCCTTGGCGACACGGAAAGCACAGAC
GACGAGCAAGCAGGCCACGCCGCAAAGAAGCGCAAAACATTGGACCACAAGCGCGCCCGCCTCGAGTCGCAAAGG
GCCTCGCGCCGCCAACGCGCCCAGCTCGAAGCCCTAGTCGACGCCAAGCTGCACCTCTCCAACCACGACCTCGTC
TCCCACACCAAGCAGTCATCGTCTTCAGCAGCAGCAGCACCAGCCGCCCCGTTTCGATACCGCGAAACCTCGCCG
CAAACATTTGGCATGACGCCGCGCGACATTCTACTCGCCCCGTCGGACCAGGCCCTCAATGAATTCGCAGGCCTC
AAAAAACTCGCCCCCTTTCGCGACGCTGAGCGCAAGCGCCGCGACCGCAAACGCCTCGGCAAAAAGGCCCGCCTG
CGCGAGTGGCGCCGCGGCGTCTTTGGCCAAGAATTTGAGCGCGAGGGCCCAACATTTGGCTTTGAGCGCCTCGTA
CATGGGCTCGACGACTGTGGCGCGCCGGGGGAGCGCGAGGCTAGCAAGCACGGCAAAAAAACAAGACGACACGGG
GCAGACGACGAGGCTGCCACACAGGGCCAAGACAATATTGTGGGAGAGGTGGGCACATCGCGCAAGAAGCGAAAG
AGGTCCAAAGGCACAAGGAGTGCCCATGCCGAGGCTTCATAG
Transcript >OphauB2|6552
ATGGCTGCCAAATCAATTTCAGAAACGGCCTTGAAACTAGGCTCCGAGAAACGTACTCTGCTCGATAGCGACTCC
GACTCGGACTCTGATAATGGAGGAGCACCTGTCTCTCTCAAGGTGAATCAAGAATTTGCTCGACGATTCGAGCAC
AATAAGAAACGAGAAGAAATTCATAGATTAGAGGACAAATACAAGAACAAGCGCCAGCCCAACAAGCCTCAAGAT
GACGCCTCCGACGACAAAAACGACTCTTCCTCATCGAGCGAGACAGAGGATGAGGACGGATTCCTTGCAACCGAA
GACTTGGATGCCCAAATTTCTGCCACTCTGCATGCCATTCGAACCAAGGACCCCCGCGTCTACGACACAAACGTC
ACCTTTGTCCAGCTTCCCGATGACGAACAACCAGCTGCCTCGACGAATAAGAAGGAGAAGCCCGTGTTTCTACGC
GACTATCACAGGGGAAACCTTTTACGAGGCGATGCCGGCGCTTTTGACGACGAGAAACAAGCCCCCCAAACCTAC
AACCAGGAGCAACATGATTTAAAAAGGACAATCTTGTCGGAGATCAAGGCGGCAGAATCCGACAATGACTCGGAA
GATGACGGAATTGTCAAGCGTAAAGAGCCTGCAAAACCAGACGCAAATGGCCTTCACCCGACGAGGGCTGCGGCC
GTCAAGTCTGCCGCTGTAAAATTATCAGAGAAGGATATCGCCAATGCCGACGAGAACCCAGACACCTTTCTCTCC
AACTTTATGGCTGCTCGGGCCTGGATCCCAGAAGAGGGCGGCAAGTGGAAGGCATTTGAGTCTGACGATGGTGAC
GAAGACGACGTTGCCGACGAGTGGGAGCAGGCTTACAACATGCGGTTTGAAGATCCCGCAAAGAGCAACGAAGTT
TTGAAGTCGTATGCTCGAGACTTTGCCGCAGCCCGGTCGGTGCGCCGCGAAGAAAAGACGGGGAGAAGACGCCAG
CGAGAGCTTCAACGCGACAAGAAGGAGCAAGACAAGCGCCAAAAGCACGAGGAAAAGGCTCGCCTCCGCAAACTC
AAGGTGGAGGAGGCGGAGGAAAAGTTGCGCAAGGTTAGACAGGCGGCAGGTGCTCTCGGGCAAGAAATGACGCAA
GAAGCCTTGGTGCAGTTTCTGGATGAGGCCTGGGAGGATGGCAAGTGGGAGCAAGAAATGCAAAAGAGGTTTGGC
GACGACTACTACGCCATGGAGGATGACGCATCAAGGGAGGAGGAGGAGAGCGAGCATGGCAGCGAGGCAGACGAG
GCAAGCGAGACGAGGAAGAAGAAGAAGAAGAAGAAGCATCCCAAGAAGCCCAAATGGGACAATGACATTGACATT
GACGACATTGTCCCCGACTTTGCCGACGACGACGGCAAGCCTCCCATCAGCCTTGGCGACACGGAAAGCACAGAC
GACGAGCAAGCAGGCCACGCCGCAAAGAAGCGCAAAACATTGGACCACAAGCGCGCCCGCCTCGAGTCGCAAAGG
GCCTCGCGCCGCCAACGCGCCCAGCTCGAAGCCCTAGTCGACGCCAAGCTGCACCTCTCCAACCACGACCTCGTC
TCCCACACCAAGCAGTCATCGTCTTCAGCAGCAGCAGCACCAGCCGCCCCGTTTCGATACCGCGAAACCTCGCCG
CAAACATTTGGCATGACGCCGCGCGACATTCTACTCGCCCCGTCGGACCAGGCCCTCAATGAATTCGCAGGCCTC
AAAAAACTCGCCCCCTTTCGCGACGCTGAGCGCAAGCGCCGCGACCGCAAACGCCTCGGCAAAAAGGCCCGCCTG
CGCGAGTGGCGCCGCGGCGTCTTTGGCCAAGAATTTGAGCGCGAGGGCCCAACATTTGGCTTTGAGCGCCTCGTA
CATGGGCTCGACGACTGTGGCGCGCCGGGGGAGCGCGAGGCTAGCAAGCACGGCAAAAAAACAAGACGACACGGG
GCAGACGACGAGGCTGCCACACAGGGCCAAGACAATATTGTGGGAGAGGTGGGCACATCGCGCAAGAAGCGAAAG
AGGTCCAAAGGCACAAGGAGTGCCCATGCCGAGGCTTCATAG
Gene >OphauB2|6552
ATGGCTGCCAAATCAATTTCAGAAACGGCCTTGAAACTAGGCTCCGAGAAACGTACTCTGCTCGATAGCGACTCC
GACTCGGACTCTGATAATGGAGGAGCACCTGTCTCTCTCAAGGTGAATCAAGAATTTGCTCGACGATTCGAGCAC
AATAAGAAACGAGAAGAAATTCATAGATGTAGGCTCTCTCTATACGCTGACGCACGCGGTAATTTCCTAACACCC
GTCAAGTAGAGGACAAATACAAGAACAAGCGCCAGCCCAACAAGCCTCAAGATGACGCCTCCGACGACAAAAACG
ACTCTTCCTCATCGAGCGAGACAGAGGATGAGGACGGATTCCTTGCAACCGAAGACTTGGATGCCCAAATTTCTG
CCACTCTGCATGCCATTCGAACCAAGGACCCCCGCGTCTACGACACAAACGTCACCTTTGTCCAGCTTCCCGATG
ACGAACAACCAGCTGCCTCGACGAATAAGAAGGAGAAGCCCGTGTTTCTACGCGACTATCACAGGGGAAACCTTT
TACGAGGCGATGCCGGCGCTTTTGACGACGAGAAACAAGCCCCCCAAACCTACAACCAGGAGCAACATGATTTAA
AAAGGACAATCTTGTCGGAGATCAAGGCGGCAGAATCCGACAATGACTCGGAAGATGACGGAATTGTCAAGCGTA
AAGAGCCTGCAAAACCAGACGCAAATGGCCTTCACCCGACGAGGGCTGCGGCCGTCAAGTCTGCCGCTGTAAAAT
TATCAGAGAAGGATATCGCCAATGCCGACGAGAACCCAGACACCTTTCTCTCCAACTTTATGGCTGCTCGGGCCT
GGATCCCAGAAGAGGGCGGCAAGTGGAAGGCATTTGAGTCTGACGATGGTGACGAAGACGACGTTGCCGACGAGT
GGGAGCAGGCTTACAACATGCGGTTTGAAGATCCCGCAAAGAGCAACGAAGTTTTGAAGTCGTATGCTCGAGACT
TTGCCGCAGCCCGGTCGGTGCGCCGCGAAGAAAAGACGGGGAGAAGACGCCAGCGAGAGCTTCAACGCGACAAGA
AGGAGCAAGACAAGCGCCAAAAGCACGAGGAAAAGGCTCGCCTCCGCAAACTCAAGGTGGAGGAGGCGGAGGAAA
AGTTGCGCAAGGTTAGACAGGCGGCAGGTGCTCTCGGGCAAGAAATGACGCAAGAAGCCTTGGTGCAGTTTCTGG
ATGAGGCCTGGGAGGATGGCAAGTGGGAGCAAGAAATGCAAAAGAGGTTTGGCGACGACTACTACGCCATGGAGG
ATGACGCATCAAGGGAGGAGGAGGAGAGCGAGCATGGCAGCGAGGCAGACGAGGCAAGCGAGACGAGGAAGAAGA
AGAAGAAGAAGAAGCATCCCAAGAAGCCCAAATGGGACAATGACATTGACATTGACGACATTGTCCCCGACTTTG
CCGACGACGACGGCAAGCCTCCCATCAGCCTTGGCGACACGGAAAGCACAGACGACGAGCAAGCAGGCCACGCCG
CAAAGAAGCGCAAAACATTGGACCACAAGCGCGCCCGCCTCGAGTCGCAAAGGGCCTCGCGCCGCCAACGCGCCC
AGCTCGAAGCCCTAGTCGACGCCAAGCTGCACCTCTCCAACCACGACCTCGTCTCCCACACCAAGCAGTCATCGT
CTTCAGCAGCAGCAGCACCAGCCGCCCCGTTTCGATACCGCGAAACCTCGCCGCAAACATTTGGCATGACGCCGC
GCGACATTCTACTCGCCCCGTCGGACCAGGCCCTCAATGAATTCGCAGGCCTCAAAAAACTCGCCCCCTTTCGCG
ACGCTGAGCGCAAGCGCCGCGACCGCAAACGCCTCGGCAAAAAGGCCCGCCTGCGCGAGTGGCGCCGCGGCGTCT
TTGGCCAAGAATTTGAGCGCGAGGGCCCAACATTTGGCTTTGAGCGCCTCGTACATGGGCTCGACGACTGTGGCG
CGCCGGGGGAGCGCGAGGCTAGCAAGCACGGCAAAAAAACAAGACGACACGGGGCAGACGACGAGGCTGCCACAC
AGGGCCAAGACAATATTGTGGGAGAGGTGGGCACATCGCGCAAGAAGCGAAAGAGGTCCAAAGGCACAAGGAGTG
CCCATGCCGAGGCTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail