Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|655
Gene name
LocationContig_111:17491..18369
Strand-
Gene length (bp)878
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e 5.5E-37 17 151

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE25|RL17_NEUCR 60S ribosomal protein L17 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-17 PE=3 SV=1 1 187 4.0E-110
sp|Q6MY48|RL17_ASPFU 60S ribosomal protein L17 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rpl17 PE=3 SV=1 2 184 8.0E-104
sp|Q6BM53|RL17_DEBHA 60S ribosomal protein L17 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPL17 PE=3 SV=1 1 177 3.0E-83
sp|P05740|RL17A_YEAST 60S ribosomal protein L17-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL17A PE=1 SV=4 1 177 2.0E-78
sp|P46990|RL17B_YEAST 60S ribosomal protein L17-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL17B PE=1 SV=2 1 177 5.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE25|RL17_NEUCR 60S ribosomal protein L17 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rpl-17 PE=3 SV=1 1 187 4.0E-110
sp|Q6MY48|RL17_ASPFU 60S ribosomal protein L17 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rpl17 PE=3 SV=1 2 184 8.0E-104
sp|Q6BM53|RL17_DEBHA 60S ribosomal protein L17 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPL17 PE=3 SV=1 1 177 3.0E-83
sp|P05740|RL17A_YEAST 60S ribosomal protein L17-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL17A PE=1 SV=4 1 177 2.0E-78
sp|P46990|RL17B_YEAST 60S ribosomal protein L17-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL17B PE=1 SV=2 1 177 5.0E-78
sp|Q6CBS7|RL17_YARLI 60S ribosomal protein L17 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL17 PE=3 SV=1 1 177 3.0E-74
sp|P18621|RL17_HUMAN 60S ribosomal protein L17 OS=Homo sapiens GN=RPL17 PE=1 SV=3 1 164 3.0E-71
sp|Q5XTY7|RL17_FELCA 60S ribosomal protein L17 OS=Felis catus GN=RPL17 PE=2 SV=3 1 164 3.0E-71
sp|Q9CPR4|RL17_MOUSE 60S ribosomal protein L17 OS=Mus musculus GN=Rpl17 PE=1 SV=3 1 164 4.0E-71
sp|P24049|RL17_RAT 60S ribosomal protein L17 OS=Rattus norvegicus GN=Rpl17 PE=2 SV=3 1 164 4.0E-71
sp|Q3T025|RL17_BOVIN 60S ribosomal protein L17 OS=Bos taurus GN=RPL17 PE=2 SV=3 1 164 4.0E-71
sp|O14339|RL17A_SCHPO 60S ribosomal protein L17-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1701 PE=3 SV=1 1 187 9.0E-71
sp|Q0PXV9|RL17_DIACI 60S ribosomal protein L17 OS=Diaphorina citri GN=RpL17 PE=2 SV=1 1 159 2.0E-70
sp|A2I3Y6|RL17_MACHI 60S ribosomal protein L17 OS=Maconellicoccus hirsutus GN=RpL17 PE=2 SV=1 1 160 1.0E-69
sp|O59794|RL17B_SCHPO 60S ribosomal protein L17-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl1702 PE=3 SV=1 1 187 1.0E-69
sp|Q4GXH5|RL17_CARGR 60S ribosomal protein L17 OS=Carabus granulatus GN=RpL17 PE=2 SV=1 1 162 2.0E-67
sp|Q5MGD1|RL17_LONON 60S ribosomal protein L17 OS=Lonomia obliqua GN=RpL17 PE=2 SV=1 1 165 3.0E-67
sp|A8CAG3|RL17_PHLPP 60S ribosomal protein L17 OS=Phlebotomus papatasi GN=RpL17 PE=2 SV=1 1 160 3.0E-67
sp|Q5MIR6|RL17_AEDAL 60S ribosomal protein L17 OS=Aedes albopictus GN=RpL17 PE=2 SV=1 1 160 3.0E-67
sp|Q1HR65|RL17_AEDAE 60S ribosomal protein L17 OS=Aedes aegypti GN=RpL17 PE=2 SV=1 1 160 3.0E-67
sp|A0NGY0|RL17_ANOGA 60S ribosomal protein L17 OS=Anopheles gambiae GN=RpL17 PE=3 SV=1 1 160 6.0E-67
sp|Q5UAS2|RL17_BOMMO 60S ribosomal protein L17 OS=Bombyx mori GN=RpL17 PE=2 SV=1 1 165 2.0E-66
sp|Q4GXH6|RL17_BIPLU 60S ribosomal protein L17 OS=Biphyllus lunatus GN=RpL17 PE=2 SV=1 1 162 5.0E-66
sp|O48557|RL17_MAIZE 60S ribosomal protein L17 OS=Zea mays GN=RPL17 PE=2 SV=1 1 164 4.0E-65
sp|Q4PM54|RL17_IXOSC 60S ribosomal protein L17 OS=Ixodes scapularis GN=RpL17 PE=2 SV=1 1 157 9.0E-65
sp|Q29IM3|RL17_DROPS 60S ribosomal protein L17 OS=Drosophila pseudoobscura pseudoobscura GN=RpL17 PE=3 SV=1 1 167 1.0E-64
sp|P37380|RL17_PODCA 60S ribosomal protein L17 OS=Podocoryna carnea GN=RPL17 PE=2 SV=1 1 160 1.0E-64
sp|Q6XJ13|RL17_DROYA 60S ribosomal protein L17 OS=Drosophila yakuba GN=RpL17 PE=2 SV=1 1 160 5.0E-64
sp|Q9BL19|RL17_CAEEL 60S ribosomal protein L17 OS=Caenorhabditis elegans GN=rpl-17 PE=3 SV=1 2 159 7.0E-64
sp|Q09JW2|RL17_ARGMO 60S ribosomal protein L17 OS=Argas monolakensis GN=RpL17 PE=2 SV=1 1 157 1.0E-63
sp|Q93VI3|RL171_ARATH 60S ribosomal protein L17-1 OS=Arabidopsis thaliana GN=RPL17A PE=2 SV=1 1 159 2.0E-63
sp|Q9W3W8|RL17_DROME 60S ribosomal protein L17 OS=Drosophila melanogaster GN=RpL17 PE=1 SV=1 1 160 2.0E-63
sp|P35266|RL171_HORVU 60S ribosomal protein L17-1 OS=Hordeum vulgare PE=2 SV=1 1 159 5.0E-63
sp|P51413|RL172_ARATH 60S ribosomal protein L17-2 OS=Arabidopsis thaliana GN=RPL17B PE=2 SV=2 1 159 6.0E-63
sp|Q4GXH7|RL17_AGRLI 60S ribosomal protein L17 OS=Agriotes lineatus GN=RpL17 PE=2 SV=1 1 156 7.0E-63
sp|P35267|RL172_HORVU 60S ribosomal protein L17-2 OS=Hordeum vulgare PE=2 SV=1 1 164 1.0E-62
sp|Q4KTG9|RL17_SUBDO 60S ribosomal protein L17 OS=Suberites domuncula GN=RPL17 PE=2 SV=1 1 162 2.0E-61
sp|Q5I5J1|RL17_PECGU 60S ribosomal protein L17 OS=Pectinaria gouldii GN=rpl-17 PE=2 SV=1 1 161 2.0E-60
sp|Q4N4B9|RL17_THEPA 60S ribosomal protein L17 OS=Theileria parva GN=RPL17 PE=3 SV=1 1 175 3.0E-55
sp|Q4UF75|RL17_THEAN 60S ribosomal protein L17 OS=Theileria annulata GN=RPL17 PE=3 SV=1 1 175 2.0E-54
sp|Q54NG2|RL17_DICDI 60S ribosomal protein L17 OS=Dictyostelium discoideum GN=rpl17 PE=3 SV=1 4 159 1.0E-46
sp|P0DJ16|RL17_TETTS 60S ribosomal protein L17 OS=Tetrahymena thermophila (strain SB210) GN=RPL17 PE=1 SV=1 4 159 3.0E-41
sp|P54033|RL22_METJA 50S ribosomal protein L22 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl22 PE=3 SV=1 8 152 6.0E-25
sp|A6UWU2|RL22_META3 50S ribosomal protein L22 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl22 PE=3 SV=1 7 152 8.0E-25
sp|A8AA19|RL22_IGNH4 50S ribosomal protein L22 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl22 PE=3 SV=1 8 154 6.0E-22
sp|Q5JDH4|RL22_THEKO 50S ribosomal protein L22 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl22 PE=3 SV=1 4 152 9.0E-22
sp|Q97BX2|RL22_THEVO 50S ribosomal protein L22 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl22 PE=3 SV=1 14 155 2.0E-21
sp|A5UL84|RL22_METS3 50S ribosomal protein L22 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl22 PE=3 SV=1 8 152 3.0E-21
sp|O59423|RL22_PYRHO 50S ribosomal protein L22 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl22 PE=3 SV=1 4 152 5.0E-21
sp|A6UQ48|RL22_METVS 50S ribosomal protein L22 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl22 PE=3 SV=1 7 152 8.0E-21
sp|A3DNB2|RL22_STAMF 50S ribosomal protein L22 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl22 PE=3 SV=1 12 152 1.0E-20
sp|Q4JB45|RL22_SULAC 50S ribosomal protein L22 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl22 PE=3 SV=1 4 152 2.0E-20
sp|Q8TX36|RL22_METKA 50S ribosomal protein L22 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl22 PE=3 SV=1 8 152 4.0E-20
sp|Q9V1U0|RL22_PYRAB 50S ribosomal protein L22 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl22 PE=3 SV=1 4 152 4.0E-20
sp|O26115|RL22_METTH 50S ribosomal protein L22 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl22 PE=3 SV=1 2 152 6.0E-20
sp|Q46GA0|RL22_METBF 50S ribosomal protein L22 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl22 PE=3 SV=1 2 152 6.0E-20
sp|Q12ZU6|RL22_METBU 50S ribosomal protein L22 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl22 PE=3 SV=1 2 152 3.0E-19
sp|O28359|RL22_ARCFU 50S ribosomal protein L22 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl22 PE=3 SV=1 2 149 3.0E-19
sp|P10970|RL22_HALMA 50S ribosomal protein L22 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl22 PE=1 SV=2 6 154 3.0E-19
sp|A2BMC4|RL22_HYPBU 50S ribosomal protein L22 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl22 PE=3 SV=1 13 154 3.0E-19
sp|Q8U003|RL22_PYRFU 50S ribosomal protein L22 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl22 PE=1 SV=1 4 152 6.0E-19
sp|Q8PV45|RL22_METMA 50S ribosomal protein L22 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl22 PE=3 SV=1 11 152 5.0E-18
sp|Q975I6|RL22_SULTO 50S ribosomal protein L22 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl22 PE=3 SV=1 4 152 5.0E-18
sp|P62649|RL22_METMP 50S ribosomal protein L22 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl22 PE=3 SV=1 7 152 8.0E-18
sp|A8MBL4|RL22_CALMQ 50S ribosomal protein L22 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl22 PE=3 SV=1 3 152 1.0E-17
sp|A6VGY9|RL22_METM7 50S ribosomal protein L22 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl22 PE=3 SV=1 7 152 2.0E-17
sp|A9A9R0|RL22_METM6 50S ribosomal protein L22 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl22 PE=3 SV=1 7 152 2.0E-17
sp|A4FWB7|RL22_METM5 50S ribosomal protein L22 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl22 PE=3 SV=1 7 152 2.0E-17
sp|Q9HIR4|RL22_THEAC 50S ribosomal protein L22 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl22 PE=3 SV=1 15 155 2.0E-17
sp|Q8TRU2|RL22_METAC 50S ribosomal protein L22 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl22 PE=3 SV=1 11 152 3.0E-17
sp|A3MTL6|RL22_PYRCJ 50S ribosomal protein L22 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl22 PE=3 SV=2 9 159 6.0E-17
sp|Q9UXA2|RL22_SULSO 50S ribosomal protein L22 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl22 PE=3 SV=2 3 154 7.0E-16
sp|A4YCX1|RL22_METS5 50S ribosomal protein L22 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl22 PE=3 SV=1 24 152 1.0E-15
sp|Q18GF4|RL22_HALWD 50S ribosomal protein L22 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl22 PE=3 SV=1 11 156 1.0E-15
sp|P15008|RL22_HALSA 50S ribosomal protein L22 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl22 PE=1 SV=2 6 157 2.0E-15
sp|Q3IMY3|RL22_NATPD 50S ribosomal protein L22 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl22 PE=3 SV=1 6 155 2.0E-15
sp|Q6L1C2|RL22_PICTO 50S ribosomal protein L22 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl22 PE=3 SV=1 1 155 2.0E-15
sp|A0RVX8|RL22_CENSY 50S ribosomal protein L22 OS=Cenarchaeum symbiosum (strain A) GN=rpl22 PE=3 SV=1 4 152 2.0E-15
sp|Q9YF76|RL22_AERPE 50S ribosomal protein L22 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl22 PE=3 SV=1 31 152 4.0E-15
sp|A0B9W5|RL22_METTP 50S ribosomal protein L22 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl22 PE=3 SV=1 12 152 4.0E-15
sp|Q8ZWH7|RL22_PYRAE 50S ribosomal protein L22 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl22 PE=3 SV=2 1 159 1.0E-14
sp|A9A5J0|RL22_NITMS 50S ribosomal protein L22 OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl22 PE=3 SV=1 24 152 4.0E-14
sp|A2SPK8|RL22_METLZ 50S ribosomal protein L22 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl22 PE=3 SV=1 15 152 7.0E-14
sp|A4WIY9|RL22_PYRAR 50S ribosomal protein L22 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl22 PE=3 SV=1 1 159 8.0E-14
sp|Q0W1Y4|RL22_METAR 50S ribosomal protein L22 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl22 PE=3 SV=1 2 152 2.0E-13
sp|B1YD24|RL22_PYRNV 50S ribosomal protein L22 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl22 PE=3 SV=1 15 159 3.0E-13
sp|A1RVA1|RL22_PYRIL 50S ribosomal protein L22 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl22 PE=3 SV=2 1 159 4.0E-13
sp|Q2NFW1|RL22_METST 50S ribosomal protein L22 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl22 PE=3 SV=1 13 153 2.0E-12
sp|A3CT02|RL22_METMJ 50S ribosomal protein L22 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl22 PE=3 SV=1 4 152 3.0E-12
sp|A1RXG7|RL22_THEPD 50S ribosomal protein L22 OS=Thermofilum pendens (strain Hrk 5) GN=rpl22 PE=3 SV=2 6 154 6.0E-12
sp|A7I5P4|RL22_METB6 50S ribosomal protein L22 OS=Methanoregula boonei (strain 6A8) GN=rpl22 PE=3 SV=1 1 152 2.0E-11
sp|Q2FT36|RL22_METHJ 50S ribosomal protein L22 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl22 PE=3 SV=1 15 154 3.0E-11
sp|A1VEB1|RL22_DESVV 50S ribosomal protein L22 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplV PE=3 SV=1 15 155 3.0E-10
sp|Q72CH5|RL22_DESVH 50S ribosomal protein L22 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplV PE=3 SV=1 15 155 3.0E-10
sp|B8DNA1|RL22_DESVM 50S ribosomal protein L22 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplV PE=3 SV=1 15 155 6.0E-10
sp|Q1MPQ8|RL22_LAWIP 50S ribosomal protein L22 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplV PE=3 SV=1 84 155 3.0E-08
sp|B8IYH7|RL22_DESDA 50S ribosomal protein L22 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplV PE=3 SV=1 84 155 2.0E-07
sp|B8G1X1|RL22_DESHD 50S ribosomal protein L22 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplV PE=3 SV=1 15 155 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:1901576 organic substance biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0009059 macromolecule biosynthetic process No
GO:0005198 structural molecule activity No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0009058 biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1283
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2162
Ophiocordyceps australis map64 (Brazil) OphauB2|655 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06105
Ophiocordyceps camponoti-rufipedis Ophun1|5977
Ophiocordyceps kimflemingae Ophio5|7761
Ophiocordyceps subramaniannii Hirsu2|10578

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|655
MVRYAATEIHPSKSARARGAYLRVSFKNTRETAQAINGWKLQRAIAFLENVKEHKEAVPMRRYAGSTGRCAQGKQ
FGVSKARWPLKSAQYLLDLLRNAESNADAKGLDTGALIVKHIQVNQAPKQRRRTYRAHGRINPYMSNPCHIELIL
TEGEEVVQKADQVVDREQLRLNSRQRGSRIRKAINAA*
Coding >OphauB2|655
ATGGTCCGATACGCTGCGACCGAGATTCACCCCTCCAAGTCAGCCCGCGCCCGCGGTGCCTACTTGCGAGTATCC
TTTAAAAACACTCGCGAGACAGCCCAGGCCATCAACGGCTGGAAGCTGCAGCGGGCAATTGCGTTCCTGGAGAAT
GTAAAGGAACACAAGGAGGCAGTACCAATGCGACGATATGCCGGCAGCACTGGCCGCTGCGCTCAAGGCAAGCAG
TTCGGTGTCTCCAAAGCTCGGTGGCCCCTCAAGTCGGCTCAGTACCTACTGGATTTGCTCAGAAACGCCGAATCC
AACGCCGATGCCAAGGGCCTTGATACTGGTGCTTTGATCGTCAAGCACATCCAGGTTAACCAAGCCCCCAAGCAG
CGCCGCCGAACATACCGTGCACATGGTCGTATCAATCCTTATATGTCGAACCCATGCCACATTGAGTTGATTTTG
ACCGAAGGCGAGGAGGTTGTGCAGAAAGCCGACCAGGTTGTTGATCGAGAACAACTCCGTCTCAACTCAAGACAG
CGTGGCTCGCGTATTCGCAAGGCTATCAATGCTGCCTAA
Transcript >OphauB2|655
ATGGTCCGATACGCTGCGACCGAGATTCACCCCTCCAAGTCAGCCCGCGCCCGCGGTGCCTACTTGCGAGTATCC
TTTAAAAACACTCGCGAGACAGCCCAGGCCATCAACGGCTGGAAGCTGCAGCGGGCAATTGCGTTCCTGGAGAAT
GTAAAGGAACACAAGGAGGCAGTACCAATGCGACGATATGCCGGCAGCACTGGCCGCTGCGCTCAAGGCAAGCAG
TTCGGTGTCTCCAAAGCTCGGTGGCCCCTCAAGTCGGCTCAGTACCTACTGGATTTGCTCAGAAACGCCGAATCC
AACGCCGATGCCAAGGGCCTTGATACTGGTGCTTTGATCGTCAAGCACATCCAGGTTAACCAAGCCCCCAAGCAG
CGCCGCCGAACATACCGTGCACATGGTCGTATCAATCCTTATATGTCGAACCCATGCCACATTGAGTTGATTTTG
ACCGAAGGCGAGGAGGTTGTGCAGAAAGCCGACCAGGTTGTTGATCGAGAACAACTCCGTCTCAACTCAAGACAG
CGTGGCTCGCGTATTCGCAAGGCTATCAATGCTGCCTAA
Gene >OphauB2|655
ATGGTAAGTGGTGCATTATGCCAGCGTCATTTGGAAGACTGGCGACGCTGGCTTGATGCCTCTGTCATTGGCATA
CAGCCAGCAGTAGCTCTCTAATGTAACACTTCAACAAGGACTGACCATGACAACTTGGCGACAGGTCCGATACGC
TGCGACCGAGATTCACCCCTCCAAGTCAGCCCGCGCCCGCGGTGCCTACTTGCGAGTATCCTTTAAAAACACTCG
CGAGACAGCCCAGGCCATCAACGGCTGGAAGCTGCAGCGGGCAATTGCGTTCCTGGAGAATGTAAAGGAACACAA
GGAGGCAGTACCAATGCGACGATATGCCGGCAGCACTGGCCGCTGCGCTCAAGGTACGAGATGACTCTCGACAAT
TGTCGGAGTCTGGCTTGGGGCAAATTTCTCGGCCCCCGCGCCTTAATTGCAACACGCCATGACCAGCTGCTGACA
TTGTTTTTCCCATCATAGGCAAGCAGTTCGGTGTCTCCAAAGCTCGGTGGCCCCTCAAGTCGGCTCAGTACCTAC
TGGATTTGCTCAGAAACGCCGAATCCAACGCCGATGCCAAGGGCCTTGATACTGGTGCTTTGATCGTCAAGCACA
TCCAGGTTAACCAAGCCCCCAAGCAGCGCCGCCGAACATACCGTGCACATGGTCGTGTATGTCTGCCTTTGACTT
GCCGGCATCATCTCCCTAGGACATTTTTGAACTGACTGGTCTAGATCAATCCTTATATGTCGAACCCATGCCACA
TTGAGTTGATTTTGACCGAAGGCGAGGAGGTTGTGCAGAAAGCCGACCAGGTTGTTGATCGAGAACAACTCCGTC
TCAACTCAAGACAGCGTGGCTCGCGTATTCGCAAGGCTATCAATGCTGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail