Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|6545
Gene name
LocationContig_60:2018..6863
Strand+
Gene length (bp)4845
Transcript length (bp)4635
Coding sequence length (bp)4635
Protein length (aa) 1545

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 2.0E-15 912 980
PF07529 HSA HSA domain 6.8E-11 643 693

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB96|AEF1_GIBZE Chromatin modification-related protein EAF1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EAF1 PE=3 SV=1 1 1419 0.0E+00
sp|Q7SBU6|EAF1_NEUCR Chromatin modification-related protein eaf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eaf-1 PE=3 SV=1 526 1209 1.0E-176
sp|Q4WP03|EAF1_ASPFU Chromatin modification-related protein eaf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf1 PE=3 SV=1 471 1207 4.0E-138
sp|Q5B4Q8|EAF1_EMENI Chromatin modification-related protein eaf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf1 PE=3 SV=1 62 1207 6.0E-132
sp|Q756L0|EAF1_ASHGO Chromatin modification-related protein EAF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EAF1 PE=3 SV=2 591 1046 5.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IB96|AEF1_GIBZE Chromatin modification-related protein EAF1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=EAF1 PE=3 SV=1 1 1419 0.0E+00
sp|Q7SBU6|EAF1_NEUCR Chromatin modification-related protein eaf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eaf-1 PE=3 SV=1 526 1209 1.0E-176
sp|Q4WP03|EAF1_ASPFU Chromatin modification-related protein eaf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eaf1 PE=3 SV=1 471 1207 4.0E-138
sp|Q5B4Q8|EAF1_EMENI Chromatin modification-related protein eaf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eaf1 PE=3 SV=1 62 1207 6.0E-132
sp|Q756L0|EAF1_ASHGO Chromatin modification-related protein EAF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EAF1 PE=3 SV=2 591 1046 5.0E-24
sp|O59773|EAF_SCHPO Chromatin modification-related protein vid21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vid21 PE=1 SV=2 589 1160 8.0E-22
sp|Q4P209|EAF11_USTMA Chromatin modification-related protein EAF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EAF1 PE=3 SV=1 595 686 3.0E-16
sp|Q6CMB8|EAF1_KLULA Chromatin modification-related protein EAF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EAF1 PE=3 SV=1 887 1088 2.0E-15
sp|P0CO99|EAF1_CRYNB Chromatin modification-related protein EAF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EAF1 PE=3 SV=1 618 701 4.0E-15
sp|P0CO98|EAF1_CRYNJ Chromatin modification-related protein EAF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EAF1 PE=3 SV=1 618 701 4.0E-15
sp|Q6C7K8|EAF1_YARLI Chromatin modification-related protein EAF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF1 PE=3 SV=1 899 1094 1.0E-13
sp|Q6C7K8|EAF1_YARLI Chromatin modification-related protein EAF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EAF1 PE=3 SV=1 591 735 3.0E-13
sp|Q5A119|EAF1_CANAL Chromatin modification-related protein EAF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EAF1 PE=3 SV=1 904 1090 1.0E-12
sp|Q06337|EAF1_YEAST Chromatin modification-related protein EAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF1 PE=1 SV=2 887 1092 6.0E-12
sp|Q7SBU6|EAF1_NEUCR Chromatin modification-related protein eaf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=eaf-1 PE=3 SV=1 1 84 1.0E-11
sp|Q6CMB8|EAF1_KLULA Chromatin modification-related protein EAF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EAF1 PE=3 SV=1 591 686 2.0E-10
sp|Q6BI82|EAF1_DEBHA Chromatin modification-related protein EAF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EAF1 PE=3 SV=2 899 1090 7.0E-09
sp|Q6BI82|EAF1_DEBHA Chromatin modification-related protein EAF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EAF1 PE=3 SV=2 591 686 1.0E-08
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 619 684 3.0E-08
sp|Q06337|EAF1_YEAST Chromatin modification-related protein EAF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EAF1 PE=1 SV=2 591 686 4.0E-07
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 623 677 5.0E-07
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 619 680 7.0E-07
sp|Q4P209|EAF11_USTMA Chromatin modification-related protein EAF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EAF1 PE=3 SV=1 912 1087 1.0E-06
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 620 685 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3547
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|693
Ophiocordyceps australis map64 (Brazil) OphauB2|6545 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01944
Ophiocordyceps camponoti-rufipedis Ophun1|7276
Ophiocordyceps kimflemingae Ophio5|5914
Ophiocordyceps subramaniannii Hirsu2|6802

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|6545
MTEVGPSSDLSRNLQSRRNECSAIVTSRKRKLRELFAVATHVSTLPNDGFANPDAPAATAAEWQFLQASDIMQGK
TLNESNIPARPNLSLDKIRQSFAEAIQIKKAKAASSESTSKNTAKPCSGTQLHEAVTVNSDGPVAAVPLDNSVKP
LAPVPSPSVAAPKSAQIKSIDGALGNGCKPAMDPGTTEAQTGRDGAQKASRPRRDAETEEEASRRSAQVKFIPGT
KGSPTTAPEGLVSKASHVKPPLERTNNVDAVDARRGSNGSLSIKLPSDTAKVPETMSTPGSTAASAATPAVHDHS
TDTSPDHEGVRCVEAVEATVERASKSEAEEKQESVKVSRPTSSSAQDELLQKAIQSSIHSPKKGLTAPTTHVGAN
KVQDGATAATKNHKKDSCTTQAPLPPPCSSPRPLKTPLKSQKADSDKMTASIVEEKQQDGRNSSNRGSEEHHTPV
QSPPAPSPVEKNRQDQPQVSERAVTRVSSGALRRKSVNEIVGAMSRSAPCSSREVTKRSHDQLTPVTSTPQSPAS
RVRSIAAKRKVRVKGHAPKVLFGKQPKRHEDKALASGHKESVQASDDYYTPLFVQNFTMASKWMQPLDRMLFQAS
KTISSPDASLVIEDHQFCKVLRRVYHLQQHEKWCLRQPKRCAEPVRPPSHMDVLIQEMKWMRTDFREERKWKMCI
ARTLATACAEWVEASAEERLLLQVAAAVGPKRQASMQEEMAMQVDAEDFEMQTSTVLSPPGEDKCAQGMDMMDDL
AEAISPSALFALHDDDVVFGMQRTAAADKLLNELPMYGAPLNTAAQQDAKVDYDADAHWRRPALPLSKYVEGEMR
LVESPRLQKRTRYVFRDEDSADEEEESVEGQLGVSAVLAPRASEVSLFSPDCKAIRDRLHAGHQFRPPSEFPMPL
QSFFECRSSSQWTLAEDDELRGLVREYSYNWSLISTMLGSRSIFSGGAERRTPWECFERWINLEGLPADMQKTQY
FKAYNARIESAQRLIAQQNQQAAQQANTAGTSIAAVRRRPTIPMRVERRRNQKHLTMIEAMRKLAKKRETAAQKQ
QHSASQHPNKKANDNYPRGTARTPQEYSLLRWERDQALAEKVVQYTQRHEAQKRALLQAQARAQSQGTGVNVSVG
SAVGRQVAQQYAANQMRRMSMQPASNGVGLGPMGGAAGLHVNGVAQAQMQSALQPQHRMPVPNQPPDANLMLRAQ
RISEQQRAAVQHQHQQQQVLAQQQQQQHHQHQHLAQPLAPQQQQQPPPPPPPPPPQQQQQSQQQPRQATPGTPGP
AASQHSSPPLRNGVNALGQASFVNNAQALMASYTATTATMNGHATPQTNGLHMASPVSVSSPGPRPHAQLTPVMS
AQLSQLEASIRAKNPNMPPDHVRQLATGELTRALMTQRQNAMNAAAGQPGQTSLPNGMTATTSPHQYAALLRQQQ
QQQQQQRHIQQQHVQPPQQRHPPQPQPHPHAQQQQQRPPQQLQHQQRAVQLQHQQLQQSPVVAASPTPNQPVAPV
ALPPATSTPTPTLTPTAAAASPALSHQRPSSGSATPSNMANGSN*
Coding >OphauB2|6545
ATGACTGAGGTCGGGCCCTCCTCCGACTTGTCGAGGAACCTTCAATCCAGACGCAATGAATGCAGTGCAATTGTA
ACTTCACGGAAGCGCAAGCTTCGTGAGCTCTTCGCGGTCGCGACCCACGTTAGCACGCTACCAAATGATGGCTTT
GCGAATCCCGACGCGCCAGCAGCCACGGCGGCCGAATGGCAGTTTCTGCAAGCAAGTGACATCATGCAGGGCAAG
ACGCTTAATGAGTCAAACATACCTGCGAGACCGAACTTATCACTGGACAAGATTAGACAATCCTTTGCAGAGGCT
ATACAGATCAAAAAGGCCAAGGCTGCATCGTCTGAATCGACAAGCAAGAATACAGCCAAACCCTGCTCAGGAACC
CAGCTTCACGAAGCCGTCACTGTGAATAGCGATGGTCCTGTGGCCGCAGTGCCGTTGGATAACTCTGTAAAACCA
CTCGCTCCCGTACCGTCGCCCTCTGTTGCCGCGCCCAAGTCGGCGCAAATCAAGTCGATTGATGGAGCTCTCGGC
AATGGATGCAAGCCTGCGATGGATCCCGGCACAACAGAAGCGCAGACTGGTCGCGACGGTGCTCAAAAGGCTAGC
CGTCCAAGGCGGGATGCGGAAACAGAAGAAGAGGCCTCTCGTCGGTCGGCGCAGGTCAAGTTTATCCCAGGAACC
AAGGGTTCGCCAACGACTGCGCCTGAGGGTCTTGTGTCCAAAGCGAGCCACGTTAAGCCGCCTTTGGAAAGGACA
AACAATGTGGATGCTGTGGATGCTCGCCGGGGAAGCAATGGGTCACTGTCAATCAAGCTGCCGTCAGACACAGCC
AAAGTCCCAGAGACCATGTCAACTCCTGGCTCGACTGCTGCCAGTGCCGCCACGCCGGCCGTACACGACCACTCC
ACAGACACAAGCCCAGATCATGAGGGCGTACGCTGTGTTGAAGCTGTCGAGGCGACGGTTGAGAGGGCATCAAAG
AGTGAAGCTGAGGAAAAACAGGAGAGTGTCAAGGTTTCCAGGCCGACGTCATCGAGTGCACAAGACGAGCTATTA
CAAAAGGCCATTCAGTCGTCTATTCACTCTCCTAAGAAAGGCCTGACGGCGCCAACGACGCATGTCGGCGCGAAT
AAAGTTCAGGATGGAGCCACAGCTGCGACCAAGAATCATAAAAAAGACAGCTGCACAACACAAGCACCTCTCCCG
CCCCCGTGCTCCTCTCCACGCCCCTTGAAGACACCACTCAAGAGCCAAAAGGCCGACTCTGACAAGATGACGGCA
AGTATTGTGGAAGAAAAGCAACAGGATGGGCGAAACAGCTCGAATAGGGGCTCCGAGGAACACCACACGCCAGTT
CAAAGCCCACCAGCTCCAAGCCCAGTGGAAAAGAACAGACAGGATCAGCCGCAAGTCTCAGAGCGTGCGGTAACG
CGAGTGTCGTCTGGAGCTCTGCGGCGCAAGTCAGTCAATGAGATTGTAGGGGCAATGTCTCGATCAGCACCGTGC
TCGAGTCGAGAGGTGACCAAGAGGTCGCACGATCAGCTAACTCCAGTCACATCGACTCCACAGTCGCCCGCCTCG
CGGGTGCGAAGCATAGCTGCCAAACGAAAGGTTAGGGTCAAGGGTCACGCGCCCAAGGTTTTGTTTGGCAAACAA
CCCAAACGCCATGAAGACAAGGCGCTTGCTTCTGGGCATAAGGAGAGTGTGCAGGCGTCAGACGACTATTACACG
CCTCTGTTTGTGCAAAACTTTACCATGGCGTCCAAATGGATGCAGCCTCTTGACAGAATGCTTTTCCAAGCCAGC
AAGACGATTTCGTCGCCTGATGCTAGCCTAGTTATTGAAGACCACCAGTTTTGCAAGGTTTTGCGACGGGTCTAT
CACTTGCAGCAACACGAGAAATGGTGCCTGCGACAGCCGAAGCGATGCGCCGAGCCAGTTCGGCCGCCGTCGCAC
ATGGATGTCTTGATACAGGAGATGAAGTGGATGCGCACCGACTTTCGAGAGGAGCGCAAATGGAAAATGTGCATT
GCACGCACTCTGGCTACTGCGTGTGCGGAATGGGTCGAGGCGTCGGCAGAGGAGCGGCTGTTGCTGCAGGTGGCG
GCAGCTGTTGGGCCAAAAAGACAAGCAAGCATGCAGGAGGAAATGGCCATGCAAGTGGATGCAGAAGACTTTGAA
ATGCAAACGTCGACGGTTCTCTCGCCTCCGGGAGAAGACAAGTGTGCGCAAGGCATGGACATGATGGACGACTTG
GCCGAGGCAATCTCTCCGTCGGCCTTGTTCGCGCTCCACGACGACGACGTTGTGTTTGGGATGCAACGAACAGCT
GCGGCAGACAAGCTCCTCAACGAGTTGCCCATGTACGGCGCGCCGCTCAACACGGCGGCGCAGCAAGACGCAAAG
GTGGATTACGACGCGGACGCGCACTGGCGACGGCCAGCGTTGCCGCTGAGCAAATACGTTGAGGGAGAAATGAGG
CTTGTGGAGTCGCCGCGGCTACAGAAACGCACGCGATATGTCTTTCGGGACGAGGATTCAGCCGACGAAGAGGAA
GAATCGGTCGAGGGTCAGCTTGGCGTGAGCGCGGTGCTTGCGCCTCGAGCAAGCGAGGTGTCGCTATTCAGCCCG
GACTGCAAGGCGATACGCGACCGTTTGCACGCAGGCCATCAGTTCCGGCCTCCATCCGAGTTTCCCATGCCGCTG
CAGAGCTTCTTTGAGTGCCGGAGCTCGTCGCAATGGACGCTGGCAGAAGACGATGAGCTGCGGGGGCTGGTTAGA
GAGTACTCATACAATTGGTCTCTCATCTCAACCATGTTGGGCAGCAGGTCGATTTTCAGCGGCGGGGCCGAGCGA
CGGACGCCGTGGGAGTGCTTTGAGCGGTGGATCAACCTCGAGGGCCTTCCGGCCGACATGCAAAAGACGCAGTAC
TTCAAGGCGTACAATGCGAGGATCGAGTCGGCACAGCGGCTGATTGCACAGCAGAACCAGCAGGCGGCGCAACAG
GCCAACACGGCGGGCACGTCGATTGCAGCGGTGCGGCGCAGACCGACGATTCCGATGCGGGTGGAGCGACGGCGC
AACCAAAAGCATCTGACCATGATTGAGGCCATGAGGAAGCTTGCCAAGAAGCGCGAGACGGCAGCGCAGAAGCAG
CAACACTCGGCGTCGCAGCACCCCAACAAGAAGGCCAACGACAACTACCCCCGCGGCACGGCGCGAACACCGCAA
GAGTACAGCCTGCTGCGATGGGAGCGAGACCAGGCACTGGCGGAAAAGGTGGTGCAGTACACGCAGCGGCACGAG
GCGCAGAAGCGCGCCTTGCTCCAGGCCCAGGCGCGCGCGCAGAGCCAAGGCACAGGCGTTAATGTCAGCGTGGGC
AGCGCCGTGGGGCGGCAGGTGGCGCAGCAGTATGCCGCCAATCAGATGCGGCGCATGTCGATGCAGCCGGCCAGC
AACGGCGTCGGCCTGGGGCCCATGGGCGGCGCCGCCGGCCTCCATGTCAACGGCGTGGCGCAGGCCCAGATGCAG
AGCGCGCTCCAGCCACAGCACCGCATGCCCGTGCCCAATCAGCCGCCCGACGCCAACCTGATGCTGCGCGCCCAG
CGCATTTCGGAGCAACAGCGGGCCGCCGTCCAGCACCAGCACCAGCAACAGCAGGTGCTAGCCCAGCAGCAGCAG
CAGCAGCATCATCAGCATCAGCATCTGGCACAGCCACTTGCACCCCAACAGCAACAACAACCACCACCACCACCA
CCACCACCACCACCACAACAACAACAACAATCACAGCAACAGCCGCGTCAGGCCACGCCCGGCACTCCCGGCCCC
GCAGCCTCGCAGCACAGCTCGCCCCCGCTCCGCAACGGCGTCAATGCCCTTGGCCAGGCAAGCTTTGTCAACAAT
GCCCAGGCCCTCATGGCCTCGTACACGGCCACGACGGCCACCATGAATGGCCACGCCACGCCCCAGACAAACGGC
CTGCACATGGCCTCGCCCGTCAGCGTGTCGTCGCCCGGCCCGCGTCCCCATGCCCAGCTGACGCCCGTCATGAGC
GCCCAGCTCAGCCAGCTTGAAGCCAGCATCCGCGCCAAGAATCCCAACATGCCCCCCGACCATGTGCGCCAGCTG
GCCACGGGTGAGCTGACGCGCGCCCTCATGACGCAGCGCCAAAACGCCATGAATGCTGCCGCTGGCCAGCCCGGC
CAGACGTCGCTTCCCAACGGTATGACGGCCACGACGAGCCCGCACCAGTATGCCGCCTTGCTTAGACAGCAGCAG
CAGCAGCAGCAGCAGCAGCGCCATATCCAGCAGCAGCACGTCCAGCCGCCACAGCAGAGACACCCGCCGCAGCCG
CAGCCTCACCCACATGCCCAGCAGCAGCAGCAGCGTCCGCCTCAGCAGCTCCAGCACCAACAACGCGCTGTGCAG
CTTCAGCACCAGCAGCTGCAGCAGAGTCCTGTTGTTGCCGCATCGCCCACGCCAAACCAGCCTGTTGCCCCCGTT
GCGCTGCCGCCAGCAACCTCTACGCCCACGCCTACTCTCACCCCTACAGCTGCTGCTGCCAGTCCTGCTCTCTCC
CACCAGCGCCCATCGAGCGGCAGTGCTACGCCTTCCAACATGGCCAATGGCAGCAACTAG
Transcript >OphauB2|6545
ATGACTGAGGTCGGGCCCTCCTCCGACTTGTCGAGGAACCTTCAATCCAGACGCAATGAATGCAGTGCAATTGTA
ACTTCACGGAAGCGCAAGCTTCGTGAGCTCTTCGCGGTCGCGACCCACGTTAGCACGCTACCAAATGATGGCTTT
GCGAATCCCGACGCGCCAGCAGCCACGGCGGCCGAATGGCAGTTTCTGCAAGCAAGTGACATCATGCAGGGCAAG
ACGCTTAATGAGTCAAACATACCTGCGAGACCGAACTTATCACTGGACAAGATTAGACAATCCTTTGCAGAGGCT
ATACAGATCAAAAAGGCCAAGGCTGCATCGTCTGAATCGACAAGCAAGAATACAGCCAAACCCTGCTCAGGAACC
CAGCTTCACGAAGCCGTCACTGTGAATAGCGATGGTCCTGTGGCCGCAGTGCCGTTGGATAACTCTGTAAAACCA
CTCGCTCCCGTACCGTCGCCCTCTGTTGCCGCGCCCAAGTCGGCGCAAATCAAGTCGATTGATGGAGCTCTCGGC
AATGGATGCAAGCCTGCGATGGATCCCGGCACAACAGAAGCGCAGACTGGTCGCGACGGTGCTCAAAAGGCTAGC
CGTCCAAGGCGGGATGCGGAAACAGAAGAAGAGGCCTCTCGTCGGTCGGCGCAGGTCAAGTTTATCCCAGGAACC
AAGGGTTCGCCAACGACTGCGCCTGAGGGTCTTGTGTCCAAAGCGAGCCACGTTAAGCCGCCTTTGGAAAGGACA
AACAATGTGGATGCTGTGGATGCTCGCCGGGGAAGCAATGGGTCACTGTCAATCAAGCTGCCGTCAGACACAGCC
AAAGTCCCAGAGACCATGTCAACTCCTGGCTCGACTGCTGCCAGTGCCGCCACGCCGGCCGTACACGACCACTCC
ACAGACACAAGCCCAGATCATGAGGGCGTACGCTGTGTTGAAGCTGTCGAGGCGACGGTTGAGAGGGCATCAAAG
AGTGAAGCTGAGGAAAAACAGGAGAGTGTCAAGGTTTCCAGGCCGACGTCATCGAGTGCACAAGACGAGCTATTA
CAAAAGGCCATTCAGTCGTCTATTCACTCTCCTAAGAAAGGCCTGACGGCGCCAACGACGCATGTCGGCGCGAAT
AAAGTTCAGGATGGAGCCACAGCTGCGACCAAGAATCATAAAAAAGACAGCTGCACAACACAAGCACCTCTCCCG
CCCCCGTGCTCCTCTCCACGCCCCTTGAAGACACCACTCAAGAGCCAAAAGGCCGACTCTGACAAGATGACGGCA
AGTATTGTGGAAGAAAAGCAACAGGATGGGCGAAACAGCTCGAATAGGGGCTCCGAGGAACACCACACGCCAGTT
CAAAGCCCACCAGCTCCAAGCCCAGTGGAAAAGAACAGACAGGATCAGCCGCAAGTCTCAGAGCGTGCGGTAACG
CGAGTGTCGTCTGGAGCTCTGCGGCGCAAGTCAGTCAATGAGATTGTAGGGGCAATGTCTCGATCAGCACCGTGC
TCGAGTCGAGAGGTGACCAAGAGGTCGCACGATCAGCTAACTCCAGTCACATCGACTCCACAGTCGCCCGCCTCG
CGGGTGCGAAGCATAGCTGCCAAACGAAAGGTTAGGGTCAAGGGTCACGCGCCCAAGGTTTTGTTTGGCAAACAA
CCCAAACGCCATGAAGACAAGGCGCTTGCTTCTGGGCATAAGGAGAGTGTGCAGGCGTCAGACGACTATTACACG
CCTCTGTTTGTGCAAAACTTTACCATGGCGTCCAAATGGATGCAGCCTCTTGACAGAATGCTTTTCCAAGCCAGC
AAGACGATTTCGTCGCCTGATGCTAGCCTAGTTATTGAAGACCACCAGTTTTGCAAGGTTTTGCGACGGGTCTAT
CACTTGCAGCAACACGAGAAATGGTGCCTGCGACAGCCGAAGCGATGCGCCGAGCCAGTTCGGCCGCCGTCGCAC
ATGGATGTCTTGATACAGGAGATGAAGTGGATGCGCACCGACTTTCGAGAGGAGCGCAAATGGAAAATGTGCATT
GCACGCACTCTGGCTACTGCGTGTGCGGAATGGGTCGAGGCGTCGGCAGAGGAGCGGCTGTTGCTGCAGGTGGCG
GCAGCTGTTGGGCCAAAAAGACAAGCAAGCATGCAGGAGGAAATGGCCATGCAAGTGGATGCAGAAGACTTTGAA
ATGCAAACGTCGACGGTTCTCTCGCCTCCGGGAGAAGACAAGTGTGCGCAAGGCATGGACATGATGGACGACTTG
GCCGAGGCAATCTCTCCGTCGGCCTTGTTCGCGCTCCACGACGACGACGTTGTGTTTGGGATGCAACGAACAGCT
GCGGCAGACAAGCTCCTCAACGAGTTGCCCATGTACGGCGCGCCGCTCAACACGGCGGCGCAGCAAGACGCAAAG
GTGGATTACGACGCGGACGCGCACTGGCGACGGCCAGCGTTGCCGCTGAGCAAATACGTTGAGGGAGAAATGAGG
CTTGTGGAGTCGCCGCGGCTACAGAAACGCACGCGATATGTCTTTCGGGACGAGGATTCAGCCGACGAAGAGGAA
GAATCGGTCGAGGGTCAGCTTGGCGTGAGCGCGGTGCTTGCGCCTCGAGCAAGCGAGGTGTCGCTATTCAGCCCG
GACTGCAAGGCGATACGCGACCGTTTGCACGCAGGCCATCAGTTCCGGCCTCCATCCGAGTTTCCCATGCCGCTG
CAGAGCTTCTTTGAGTGCCGGAGCTCGTCGCAATGGACGCTGGCAGAAGACGATGAGCTGCGGGGGCTGGTTAGA
GAGTACTCATACAATTGGTCTCTCATCTCAACCATGTTGGGCAGCAGGTCGATTTTCAGCGGCGGGGCCGAGCGA
CGGACGCCGTGGGAGTGCTTTGAGCGGTGGATCAACCTCGAGGGCCTTCCGGCCGACATGCAAAAGACGCAGTAC
TTCAAGGCGTACAATGCGAGGATCGAGTCGGCACAGCGGCTGATTGCACAGCAGAACCAGCAGGCGGCGCAACAG
GCCAACACGGCGGGCACGTCGATTGCAGCGGTGCGGCGCAGACCGACGATTCCGATGCGGGTGGAGCGACGGCGC
AACCAAAAGCATCTGACCATGATTGAGGCCATGAGGAAGCTTGCCAAGAAGCGCGAGACGGCAGCGCAGAAGCAG
CAACACTCGGCGTCGCAGCACCCCAACAAGAAGGCCAACGACAACTACCCCCGCGGCACGGCGCGAACACCGCAA
GAGTACAGCCTGCTGCGATGGGAGCGAGACCAGGCACTGGCGGAAAAGGTGGTGCAGTACACGCAGCGGCACGAG
GCGCAGAAGCGCGCCTTGCTCCAGGCCCAGGCGCGCGCGCAGAGCCAAGGCACAGGCGTTAATGTCAGCGTGGGC
AGCGCCGTGGGGCGGCAGGTGGCGCAGCAGTATGCCGCCAATCAGATGCGGCGCATGTCGATGCAGCCGGCCAGC
AACGGCGTCGGCCTGGGGCCCATGGGCGGCGCCGCCGGCCTCCATGTCAACGGCGTGGCGCAGGCCCAGATGCAG
AGCGCGCTCCAGCCACAGCACCGCATGCCCGTGCCCAATCAGCCGCCCGACGCCAACCTGATGCTGCGCGCCCAG
CGCATTTCGGAGCAACAGCGGGCCGCCGTCCAGCACCAGCACCAGCAACAGCAGGTGCTAGCCCAGCAGCAGCAG
CAGCAGCATCATCAGCATCAGCATCTGGCACAGCCACTTGCACCCCAACAGCAACAACAACCACCACCACCACCA
CCACCACCACCACCACAACAACAACAACAATCACAGCAACAGCCGCGTCAGGCCACGCCCGGCACTCCCGGCCCC
GCAGCCTCGCAGCACAGCTCGCCCCCGCTCCGCAACGGCGTCAATGCCCTTGGCCAGGCAAGCTTTGTCAACAAT
GCCCAGGCCCTCATGGCCTCGTACACGGCCACGACGGCCACCATGAATGGCCACGCCACGCCCCAGACAAACGGC
CTGCACATGGCCTCGCCCGTCAGCGTGTCGTCGCCCGGCCCGCGTCCCCATGCCCAGCTGACGCCCGTCATGAGC
GCCCAGCTCAGCCAGCTTGAAGCCAGCATCCGCGCCAAGAATCCCAACATGCCCCCCGACCATGTGCGCCAGCTG
GCCACGGGTGAGCTGACGCGCGCCCTCATGACGCAGCGCCAAAACGCCATGAATGCTGCCGCTGGCCAGCCCGGC
CAGACGTCGCTTCCCAACGGTATGACGGCCACGACGAGCCCGCACCAGTATGCCGCCTTGCTTAGACAGCAGCAG
CAGCAGCAGCAGCAGCAGCGCCATATCCAGCAGCAGCACGTCCAGCCGCCACAGCAGAGACACCCGCCGCAGCCG
CAGCCTCACCCACATGCCCAGCAGCAGCAGCAGCGTCCGCCTCAGCAGCTCCAGCACCAACAACGCGCTGTGCAG
CTTCAGCACCAGCAGCTGCAGCAGAGTCCTGTTGTTGCCGCATCGCCCACGCCAAACCAGCCTGTTGCCCCCGTT
GCGCTGCCGCCAGCAACCTCTACGCCCACGCCTACTCTCACCCCTACAGCTGCTGCTGCCAGTCCTGCTCTCTCC
CACCAGCGCCCATCGAGCGGCAGTGCTACGCCTTCCAACATGGCCAATGGCAGCAACTAG
Gene >OphauB2|6545
ATGACTGAGGTCGGGCCCTCCTCCGACTTGTCGAGGAACCTTCAATCCAGACGCAATGAATGCAGGTGTGTTTTA
TCTTCATCGATGCAGCGAATTTTTCCGATTCCAACCTTGTAAATTTTATATTGCTAACGATGCATAGTGCAATTG
TAACTTCACGGAAGCGCAAGCTTCGTGAGCTCTTCGCGGTCGCGACCCACGTTAGCACGCTACCAAATGATGGCT
TTGCGAATCCCGACGCGCCAGCAGCCACGGCGGCCGAATGGCAGTTTCTGCAAGCAAGTGACATCATGCAGTAAG
TTTAAGCAAGAGTATACTTTTTTTTTCTCTTCATTTATGTGGTGCTTTGGCCAAGATATCCTCAAAGACGCTCTT
GCAGCTGCTTTGCTCGACCTAGGCCATGATGGATATGACTGACAGCTGTCCAGGGGCAAGACGCTTAATGAGTCA
AACATACCTGCGAGACCGAACTTATCACTGGACAAGATTAGACAATCCTTTGCAGAGGCTATACAGATCAAAAAG
GCCAAGGCTGCATCGTCTGAATCGACAAGCAAGAATACAGCCAAACCCTGCTCAGGAACCCAGCTTCACGAAGCC
GTCACTGTGAATAGCGATGGTCCTGTGGCCGCAGTGCCGTTGGATAACTCTGTAAAACCACTCGCTCCCGTACCG
TCGCCCTCTGTTGCCGCGCCCAAGTCGGCGCAAATCAAGTCGATTGATGGAGCTCTCGGCAATGGATGCAAGCCT
GCGATGGATCCCGGCACAACAGAAGCGCAGACTGGTCGCGACGGTGCTCAAAAGGCTAGCCGTCCAAGGCGGGAT
GCGGAAACAGAAGAAGAGGCCTCTCGTCGGTCGGCGCAGGTCAAGTTTATCCCAGGAACCAAGGGTTCGCCAACG
ACTGCGCCTGAGGGTCTTGTGTCCAAAGCGAGCCACGTTAAGCCGCCTTTGGAAAGGACAAACAATGTGGATGCT
GTGGATGCTCGCCGGGGAAGCAATGGGTCACTGTCAATCAAGCTGCCGTCAGACACAGCCAAAGTCCCAGAGACC
ATGTCAACTCCTGGCTCGACTGCTGCCAGTGCCGCCACGCCGGCCGTACACGACCACTCCACAGACACAAGCCCA
GATCATGAGGGCGTACGCTGTGTTGAAGCTGTCGAGGCGACGGTTGAGAGGGCATCAAAGAGTGAAGCTGAGGAA
AAACAGGAGAGTGTCAAGGTTTCCAGGCCGACGTCATCGAGTGCACAAGACGAGCTATTACAAAAGGCCATTCAG
TCGTCTATTCACTCTCCTAAGAAAGGCCTGACGGCGCCAACGACGCATGTCGGCGCGAATAAAGTTCAGGATGGA
GCCACAGCTGCGACCAAGAATCATAAAAAAGACAGCTGCACAACACAAGCACCTCTCCCGCCCCCGTGCTCCTCT
CCACGCCCCTTGAAGACACCACTCAAGAGCCAAAAGGCCGACTCTGACAAGATGACGGCAAGTATTGTGGAAGAA
AAGCAACAGGATGGGCGAAACAGCTCGAATAGGGGCTCCGAGGAACACCACACGCCAGTTCAAAGCCCACCAGCT
CCAAGCCCAGTGGAAAAGAACAGACAGGATCAGCCGCAAGTCTCAGAGCGTGCGGTAACGCGAGTGTCGTCTGGA
GCTCTGCGGCGCAAGTCAGTCAATGAGATTGTAGGGGCAATGTCTCGATCAGCACCGTGCTCGAGTCGAGAGGTG
ACCAAGAGGTCGCACGATCAGCTAACTCCAGTCACATCGACTCCACAGTCGCCCGCCTCGCGGGTGCGAAGCATA
GCTGCCAAACGAAAGGTTAGGGTCAAGGGTCACGCGCCCAAGGTTTTGTTTGGCAAACAACCCAAACGCCATGAA
GACAAGGCGCTTGCTTCTGGGCATAAGGAGAGTGTGCAGGCGTCAGACGACTATTACACGCCTCTGTTTGTGCAA
AACTTTACCATGGCGTCCAAATGGATGCAGCCTCTTGACAGAATGCTTTTCCAAGCCAGCAAGACGATTTCGTCG
CCTGATGCTAGCCTAGTTATTGAAGACCACCAGTTTTGCAAGGTTTTGCGACGGGTCTATCACTTGCAGCAACAC
GAGAAATGGTGCCTGCGACAGCCGAAGCGATGCGCCGAGCCAGTTCGGCCGCCGTCGCACATGGATGTCTTGATA
CAGGAGATGAAGTGGATGCGCACCGACTTTCGAGAGGAGCGCAAATGGAAAATGTGCATTGCACGCACTCTGGCT
ACTGCGTGTGCGGAATGGGTCGAGGCGTCGGCAGAGGAGCGGCTGTTGCTGCAGGTGGCGGCAGCTGTTGGGCCA
AAAAGACAAGCAAGCATGCAGGAGGAAATGGCCATGCAAGTGGATGCAGAAGACTTTGAAATGCAAACGTCGACG
GTTCTCTCGCCTCCGGGAGAAGACAAGTGTGCGCAAGGCATGGACATGATGGACGACTTGGCCGAGGCAATCTCT
CCGTCGGCCTTGTTCGCGCTCCACGACGACGACGTTGTGTTTGGGATGCAACGAACAGCTGCGGCAGACAAGCTC
CTCAACGAGTTGCCCATGTACGGCGCGCCGCTCAACACGGCGGCGCAGCAAGACGCAAAGGTGGATTACGACGCG
GACGCGCACTGGCGACGGCCAGCGTTGCCGCTGAGCAAATACGTTGAGGGAGAAATGAGGCTTGTGGAGTCGCCG
CGGCTACAGAAACGCACGCGATATGTCTTTCGGGACGAGGATTCAGCCGACGAAGAGGAAGAATCGGTCGAGGGT
CAGCTTGGCGTGAGCGCGGTGCTTGCGCCTCGAGCAAGCGAGGTGTCGCTATTCAGCCCGGACTGCAAGGCGATA
CGCGACCGTTTGCACGCAGGCCATCAGTTCCGGCCTCCATCCGAGTTTCCCATGCCGCTGCAGAGCTTCTTTGAG
TGCCGGAGCTCGTCGCAATGGACGCTGGCAGAAGACGATGAGCTGCGGGGGCTGGTTAGAGAGTACTCATACAAT
TGGTCTCTCATCTCAACCATGTTGGGCAGCAGGTCGATTTTCAGCGGCGGGGCCGAGCGACGGACGCCGTGGGAG
TGCTTTGAGCGGTGGATCAACCTCGAGGGCCTTCCGGCCGACATGCAAAAGACGCAGTACTTCAAGGCGTACAAT
GCGAGGATCGAGTCGGCACAGCGGCTGATTGCACAGCAGAACCAGCAGGCGGCGCAACAGGCCAACACGGCGGGC
ACGTCGATTGCAGCGGTGCGGCGCAGACCGACGATTCCGATGCGGGTGGAGCGACGGCGCAACCAAAAGCATCTG
ACCATGATTGAGGCCATGAGGAAGCTTGCCAAGAAGCGCGAGACGGCAGCGCAGAAGCAGCAACACTCGGCGTCG
CAGCACCCCAACAAGAAGGCCAACGACAACTACCCCCGCGGCACGGCGCGAACACCGCAAGAGTACAGCCTGCTG
CGATGGGAGCGAGACCAGGCACTGGCGGAAAAGGTGGTGCAGTACACGCAGCGGCACGAGGCGCAGAAGCGCGCC
TTGCTCCAGGCCCAGGCGCGCGCGCAGAGCCAAGGCACAGGCGTTAATGTCAGCGTGGGCAGCGCCGTGGGGCGG
CAGGTGGCGCAGCAGTATGCCGCCAATCAGATGCGGCGCATGTCGATGCAGCCGGCCAGCAACGGCGTCGGCCTG
GGGCCCATGGGCGGCGCCGCCGGCCTCCATGTCAACGGCGTGGCGCAGGCCCAGATGCAGAGCGCGCTCCAGCCA
CAGCACCGCATGCCCGTGCCCAATCAGCCGCCCGACGCCAACCTGATGCTGCGCGCCCAGCGCATTTCGGAGCAA
CAGCGGGCCGCCGTCCAGCACCAGCACCAGCAACAGCAGGTGCTAGCCCAGCAGCAGCAGCAGCAGCATCATCAG
CATCAGCATCTGGCACAGCCACTTGCACCCCAACAGCAACAACAACCACCACCACCACCACCACCACCACCACCA
CAACAACAACAACAATCACAGCAACAGCCGCGTCAGGCCACGCCCGGCACTCCCGGCCCCGCAGCCTCGCAGCAC
AGCTCGCCCCCGCTCCGCAACGGCGTCAATGCCCTTGGCCAGGCAAGCTTTGTCAACAATGCCCAGGCCCTCATG
GCCTCGTACACGGCCACGACGGCCACCATGAATGGCCACGCCACGCCCCAGACAAACGGCCTGCACATGGCCTCG
CCCGTCAGCGTGTCGTCGCCCGGCCCGCGTCCCCATGCCCAGCTGACGCCCGTCATGAGCGCCCAGCTCAGCCAG
CTTGAAGCCAGCATCCGCGCCAAGAATCCCAACATGCCCCCCGACCATGTGCGCCAGCTGGCCACGGGTGAGCTG
ACGCGCGCCCTCATGACGCAGCGCCAAAACGCCATGAATGCTGCCGCTGGCCAGCCCGGCCAGACGTCGCTTCCC
AACGGTATGACGGCCACGACGAGCCCGCACCAGTATGCCGCCTTGCTTAGACAGCAGCAGCAGCAGCAGCAGCAG
CAGCGCCATATCCAGCAGCAGCACGTCCAGCCGCCACAGCAGAGACACCCGCCGCAGCCGCAGCCTCACCCACAT
GCCCAGCAGCAGCAGCAGCGTCCGCCTCAGCAGCTCCAGCACCAACAACGCGCTGTGCAGCTTCAGCACCAGCAG
CTGCAGCAGAGTCCTGTTGTTGCCGCATCGCCCACGCCAAACCAGCCTGTTGCCCCCGTTGCGCTGCCGCCAGCA
ACCTCTACGCCCACGCCTACTCTCACCCCTACAGCTGCTGCTGCCAGTCCTGCTCTCTCCCACCAGCGCCCATCG
AGCGGCAGTGCTACGCCTTCCAACATGGCCAATGGCAGCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail